BioLiP

>protein
VMVNLNIHNNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRRENSFR
LEKILVSVGCTCVTPIVHHV

The query sequence (length=100) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8uss:A	107	105	0.9700	0.9065	0.9238	2.19e-64
2	5vb9:A	108	105	0.9400	0.8704	0.8952	4.58e-62	7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B
3	3jvf:B	104	102	0.5600	0.5385	0.5490	1.96e-32
4	6z1p:AR	274	82	0.2500	0.0912	0.3049	0.025
5	8tr2:A	745	28	0.1100	0.0148	0.3929	0.66	2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B
6	8jcu:3	765	28	0.1100	0.0144	0.3929	0.80	6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A
7	8opp:A	670	37	0.1100	0.0164	0.2973	2.9
8	8opt:A	783	37	0.1100	0.0140	0.2973	2.9	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
9	8htu:H	95	16	0.0800	0.0842	0.5000	3.2	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
10	8jjm:A	484	46	0.1400	0.0289	0.3043	4.1	8jjm:B
11	5vt3:B	319	22	0.1000	0.0313	0.4545	6.2	5usx:A, 5usx:B, 5vt3:A
12	4pu5:A	438	20	0.0900	0.0205	0.4500	9.3

[Back]