BioLiP

>protein
VMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLND
GVVVQVMGLLSNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF

The query sequence (length=128) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fw5:A	139	137	1.0000	0.9209	0.9343	3.98e-90	4fcm:A, 4fcm:B, 7suo:A, 7suo:B, 6ta7:D, 6ta7:E, 6ta7:F, 8th1:A, 8th1:B, 8th1:C, 8th1:D, 8th5:A, 8th5:C, 8th5:F, 8th5:B, 8th5:E, 8th5:D, 8th6:D, 8th6:C, 8th6:B, 8th6:A, 8th7:A, 8th7:B, 8v1l:A, 8v1l:B, 8v1l:C, 8v1l:D, 8v1l:E, 8v1l:F, 7xhf:A, 7xhf:B, 7xhg:B, 7xhg:C, 7xhg:D
2	8th5:I	119	128	0.9141	0.9832	0.9141	9.11e-79
3	5drv:A	131	130	0.8359	0.8168	0.8231	2.32e-75
4	3ujm:A	117	119	0.5938	0.6496	0.6387	5.14e-49	3ujm:B
5	1gyb:B	122	117	0.2891	0.3033	0.3162	2.13e-07	1gyb:D, 1gyb:C
6	2qiy:A	134	126	0.2266	0.2164	0.2302	0.007	2qiy:B
7	3u43:B	132	80	0.1562	0.1515	0.2500	0.35
8	7aqq:z	233	72	0.1641	0.0901	0.2917	0.63	7a23:q, 7a23:p, 7a24:q, 7a24:p, 7ar7:z, 7ar8:z, 7arb:z, 8bef:z, 8bpx:z, 8bq5:z, 8bq6:z
9	6uel:A	1333	55	0.1641	0.0158	0.3818	2.2	6uel:B
10	8q66:A	271	49	0.1094	0.0517	0.2857	2.7
11	8hr8:G	830	30	0.0938	0.0145	0.4000	7.8	8hr9:G, 8hr9:N
12	8hra:C	852	30	0.0938	0.0141	0.4000	7.8	8hr8:A, 8hr8:C, 8hr8:F, 8hr8:H, 8hr9:A, 8hr9:C, 8hr9:F, 8hr9:H, 8hr9:I, 8hr9:J, 8hr9:M, 8hr9:O, 8hra:D, 8hra:E, 8hra:H, 8hra:A, 8hra:B, 8hra:G, 8hrb:D, 8hrb:E, 8hrb:C, 8hrb:H, 8hrb:A, 8hrb:B, 8hrb:M, 8hrb:P, 8hrb:L, 8hrb:R, 8hrb:F, 8hrb:K, 8hrb:Q, 8hrb:G
13	7w6d:A	104	27	0.0703	0.0865	0.3333	8.1	5b09:A, 7w6d:B, 7w6e:A, 7w6e:B, 7w6f:A, 7w6f:B
14	7wnu:B	554	41	0.1016	0.0235	0.3171	9.4	7wnt:A, 7wnu:A

[Back]