BioLiP

>protein
VKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1wvl:A	80	64	0.9844	0.7875	0.9844	8.02e-40	1azp:A, 1azq:A, 1ca5:A, 1ca6:A, 8cmn:AA, 8q2m:AA, 8qpc:AA, 1wd0:A, 1wd1:A, 1wto:A, 1wtp:A, 1wtp:B, 1wtq:A, 1wtr:A, 1wtv:A, 1wtw:A, 1wtx:A, 1xyi:A
2	5b03:D	333	56	0.7656	0.1471	0.8750	1.51e-26	5b00:A, 5b00:B, 5b00:C, 5b03:A, 5b03:B, 5b03:C, 5b0k:A, 5b0k:B, 5b0k:C, 5b0k:D, 1bbx:C, 1bbx:D, 1bf4:A, 1bnz:A, 1c8c:A, 5gwv:D, 6j8v:D, 6j8w:D
3	7c1m:A	67	61	0.6094	0.5821	0.6393	3.53e-20
4	8bsj:SL	109	21	0.1719	0.1009	0.5238	2.4	8br8:SL, 8brm:SL, 8bsi:SL, 8btd:SL, 8btr:SL, 8fvy:K, 8g4s:K
5	7k5k:A	545	55	0.2031	0.0239	0.2364	2.7	7k5k:B, 7k5k:C, 7k5k:D, 7k5k:E, 7k5k:F, 6wvv:A, 6wvv:B, 6wvv:C, 6wvv:D, 6wvv:E
6	6djv:C	615	61	0.2969	0.0309	0.3115	3.3	6dju:A, 6dju:B, 6dju:C, 6djv:A, 6djv:B
7	6w6h:C	636	61	0.2969	0.0299	0.3115	3.4	6w6e:B, 6w6e:C, 6w6g:A, 6w6g:B, 6w6g:C, 6w6h:A, 6w6h:B, 6w6h:F, 6w6i:A, 6w6i:B, 6w6i:C, 6w6j:A, 6w6j:B, 6w6j:C
8	7oq6:A	399	11	0.1406	0.0226	0.8182	5.9	7oq6:B
9	2pmq:B	374	46	0.2188	0.0374	0.3043	7.0	4h2h:A, 4h2h:B, 4h2h:C, 4h2h:D, 4h2h:E, 4h2h:F, 4h2h:G, 4h2h:H, 2pmq:A
10	5kp7:A	410	64	0.2344	0.0366	0.2344	9.3	5kp8:A

[Back]