BioLiP

>protein
VKLPLPQRLLHDWANGSWVENISVRPNGNLLVSTSTPDGSVWQIKEPWKDQPEVELVYNFDQWVDRLIGIGETTPDKYVV
VGSRFYSTDPMSSHVDRTFAAMELDFSGSANKDKPAVRLIAWFPDAHLLQGVAALPWDRTKVLISDQYLLRPRAAPQKDW
TPARGQVWTLDTVTGAHEVVFANDTALDTTYRHGYDVGINGIKIRRDWLYWVNSDDGNIYRLKIDKTGHAVPPAKPEVVA
FQDTIWDDFTFGPEHEDTIWATGFNAIFAASPQGKVVTVNGVGTSDNGIMPGPTACAFGRSPHDRNILYVTGNMGEIPVD
IEHVHLKGWVRAIDTTGFHF

The query sequence (length=340) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7x2n:A	340	340	1.0000	1.0000	1.0000	0.0	7x2s:A, 7x2x:A
2	7x36:A	340	341	0.6412	0.6412	0.6393	1.28e-152	7x36:B, 7x36:C, 7x36:D
3	8bn0:A	342	102	0.0882	0.0877	0.2941	0.16	8bai:A, 8bai:B, 8bai:C, 8bai:D, 8baz:A, 8baz:B, 8bb0:A, 8bb0:B, 8bmy:A, 8bmy:B, 8bmz:A, 8bmz:B
4	6mvf:A	643	68	0.0618	0.0327	0.3088	0.42	6mvf:B, 6mvf:C, 6mvf:D, 6mvf:E, 6mvf:F
5	8b9o:A	143	61	0.0618	0.1469	0.3443	0.91
6	4eg2:A	297	53	0.0412	0.0471	0.2642	1.1	4eg2:B, 4eg2:C, 4eg2:D, 4eg2:E, 4eg2:F, 4eg2:G, 4eg2:H
7	3tmb:B	318	127	0.1059	0.1132	0.2835	1.3	3tm8:A, 3tm8:B, 3tmb:A, 3tmc:A, 3tmc:B, 3tmd:A
8	6xb5:A	240	51	0.0500	0.0708	0.3333	2.8	6xb5:B
9	6ene:A	329	56	0.0529	0.0547	0.3214	4.5	6ene:C, 6ene:B
10	4a6d:A	345	49	0.0559	0.0551	0.3878	4.5	4a6e:A
11	2yk1:H	182	109	0.0765	0.1429	0.2385	9.2	2ykl:H
12	6acx:A	1175	70	0.0647	0.0187	0.3143	9.7	6acx:B

[Back]