VIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENE
RKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQK
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fl2:NZ | 117 | 117 | 1.0000 | 1.0000 | 1.0000 | 7.76e-77 | 8fl0:NZ, 8fl3:NZ, 8fl4:NZ, 8ink:r, 8ipd:r, 8ipx:r, 8ipy:r |
2 | 8p0u:A | 621 | 75 | 0.1880 | 0.0354 | 0.2933 | 0.088 | 8p0b:A, 8p0g:A, 8z85:A, 8z8j:A, 8z8n:A, 8z8x:A, 8z90:A, 8z97:A, 8z98:A, 8z9h:A, 8z9h:H, 8z9q:A, 8z9r:A, 8z9r:H |
3 | 3s5m:A | 1094 | 49 | 0.1453 | 0.0155 | 0.3469 | 0.46 | 7di7:A, 7dij:A, 8ho4:A, 8ho5:A, 3s5h:A, 7vpe:A, 8wxw:A, 8wxz:A, 8wyu:A |
4 | 7dia:A | 1072 | 49 | 0.1453 | 0.0159 | 0.3469 | 0.48 | 3s5k:A, 8wyt:A, 8wyx:A, 8wyy:A |
5 | 6x6x:A | 417 | 54 | 0.1453 | 0.0408 | 0.3148 | 3.6 | 2wn6:A, 2wn7:A, 6x6r:A, 6x6r:B, 6x6v:A, 6x6v:B, 6x6v:C, 6x6v:D, 6x6x:B |
6 | 4zn3:A | 147 | 26 | 0.1026 | 0.0816 | 0.4615 | 4.3 | |
7 | 5it7:MM | 136 | 67 | 0.1880 | 0.1618 | 0.3284 | 4.6 | 6uz7:AM |
8 | 5mnv:I | 286 | 64 | 0.1111 | 0.0455 | 0.2031 | 5.9 |