VIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILR
AVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFE
ALNETLTLWNSPPDWAGDDRNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGNEEDRLASRAD
QLEEFVHYVKGEITKVVG
The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7uy4:A | 258 | 258 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7uy4:B |
2 | 5lpa:A | 267 | 255 | 0.4380 | 0.4232 | 0.4431 | 9.96e-70 | 6fzb:A, 6fzb:B, 5g4a:A, 5g4a:B, 5lpa:B, 5luh:A, 5luh:B |
3 | 6xz0:A | 250 | 226 | 0.2829 | 0.2920 | 0.3230 | 3.85e-38 | 6xxq:A, 6xxq:B |
4 | 6t5e:A | 439 | 55 | 0.0659 | 0.0387 | 0.3091 | 0.93 | |
5 | 4l0e:A | 440 | 117 | 0.1357 | 0.0795 | 0.2991 | 1.8 | 4l0f:A, 4pwv:A, 4pxh:A, 4pxh:C, 4pxh:E |
6 | 1no5:B | 102 | 87 | 0.1085 | 0.2745 | 0.3218 | 3.1 | 1no5:A |
7 | 7bxo:E | 125 | 38 | 0.0543 | 0.1120 | 0.3684 | 3.9 | 7aer:A, 7bxo:A, 6m6v:A |
8 | 3hj1:B | 387 | 23 | 0.0465 | 0.0310 | 0.5217 | 4.3 | 3hiy:A, 3hiy:B, 3hj1:A |
9 | 5it7:OO | 198 | 26 | 0.0504 | 0.0657 | 0.5000 | 4.5 | 6uz7:AO |
10 | 6p14:A | 265 | 26 | 0.0504 | 0.0491 | 0.5000 | 5.0 | |
11 | 4c6h:A | 291 | 82 | 0.1163 | 0.1031 | 0.3659 | 5.0 | |
12 | 6p07:A | 270 | 26 | 0.0504 | 0.0481 | 0.5000 | 5.2 | |
13 | 6p07:B | 303 | 26 | 0.0504 | 0.0429 | 0.5000 | 5.5 | 6nyv:B, 6nyw:B, 6p07:C, 6p07:D, 6p07:E, 6p07:F, 6p10:B, 6p11:B, 6p12:B, 6p13:B |
14 | 2o2c:A | 564 | 59 | 0.0620 | 0.0284 | 0.2712 | 6.8 | 2o2c:B, 2o2c:C |
15 | 3bjs:B | 376 | 72 | 0.0891 | 0.0612 | 0.3194 | 9.2 | 3bjs:A |
16 | 4n4j:A | 497 | 55 | 0.0620 | 0.0322 | 0.2909 | 9.8 | 4n4k:A, 4n4l:A, 4n4m:A, 4rwm:A |