VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENV
VWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSC
VAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yz0:A | 198 | 196 | 0.9898 | 0.9798 | 0.9898 | 3.21e-142 | 4ew9:A, 4ew9:B, 3t9g:A, 3t9g:B, 4yz0:B, 4yza:A, 4yza:B, 4yzq:A, 4yzq:B, 4yzx:A, 4yzx:B, 4z03:A, 4z03:B, 4z05:A, 4z05:B, 4z06:A, 4z06:B |
2 | 1ee6:A | 197 | 179 | 0.5051 | 0.5025 | 0.5531 | 8.54e-67 | |
3 | 3b4n:A | 314 | 137 | 0.2602 | 0.1624 | 0.3723 | 1.95e-10 | 3b4n:B, 3b8y:A, 3b90:A, 3b90:B |
4 | 4u49:B | 318 | 134 | 0.2602 | 0.1604 | 0.3806 | 7.79e-10 | |
5 | 3b8y:B | 294 | 101 | 0.2296 | 0.1531 | 0.4455 | 9.61e-10 | |
6 | 7jzw:A | 427 | 39 | 0.0816 | 0.0375 | 0.4103 | 0.28 | 6b44:A, 6b45:A, 6b47:A, 6b48:A, 7ecv:A, 7ecw:A, 7elm:A, 7elm:K, 7eln:A, 7eln:X, 7eqg:B, 7jzx:A, 7jzy:A, 7jzz:A, 6ne0:A, 7t3j:A, 7t3k:A, 7t3k:a, 7t3l:A, 7t3l:a, 7taw:A, 7taw:a, 7tax:A, 5uz9:A, 6vqv:C, 6vqw:B, 6vqx:B, 7we6:A, 7we6:X, 6whi:A, 7yhs:A |
7 | 6w1x:A | 314 | 39 | 0.0816 | 0.0510 | 0.4103 | 0.31 | |
8 | 1pj6:A | 828 | 97 | 0.1633 | 0.0386 | 0.3299 | 1.8 | 3gsi:A, 1pj5:A, 1pj7:A |
9 | 3ib7:A | 295 | 35 | 0.0765 | 0.0508 | 0.4286 | 6.8 | 2hy1:A, 2hyo:A, 2hyp:A, 3ib8:A |
10 | 1n4m:A | 345 | 81 | 0.1071 | 0.0609 | 0.2593 | 7.3 | 1gux:B, 1n4m:B, 1o9k:A, 1o9k:B, 1o9k:C, 1o9k:D, 1o9k:E, 1o9k:F, 1o9k:G, 1o9k:H, 2r7g:A, 2r7g:C |
11 | 6gau:A | 1088 | 46 | 0.0765 | 0.0138 | 0.3261 | 7.5 | 5bs8:A, 5bs8:B, 5bs8:C, 5bs8:D, 5bta:A, 5bta:B, 5bta:C, 5bta:D, 5btc:A, 5btc:B, 5btc:C, 5btc:D, 5btd:A, 5btd:B, 5btd:C, 5btd:D, 5btf:A, 5btf:B, 5btf:C, 5btf:D, 5btg:A, 5btg:B, 5btg:C, 5btg:D, 5bti:A, 5bti:B, 5bti:C, 5bti:D, 5btl:A, 5btl:B, 5btl:C, 5btl:D, 5btn:A, 5btn:B, 5btn:C, 5btn:D, 9foy:A, 9foy:B, 6gau:B, 7ugw:A, 7ugw:B, 7ugw:C, 7ugw:D |
12 | 5yo9:B | 366 | 55 | 0.0714 | 0.0383 | 0.2545 | 8.8 | 5yoa:B |
13 | 6t1z:A | 393 | 27 | 0.0612 | 0.0305 | 0.4444 | 9.7 |