BioLiP

>protein
VGLPYSELLSRFFNILRTPKFRIPPPVCLRDGKKTIFSNIQDIAEKLHRSPEHLIQYLFAELGTSGSVDGKRLVIKGKFQ
SKQMENVLRRYILEYVTCKTCKSINTELKRENRLFFMVCKSCGSTRSVSS

The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8s8h:l	134	134	0.9923	0.9627	0.9627	3.57e-90	8cas:s, 6fyx:l, 6fyy:l, 6gsm:l, 6gsn:l, 3jap:l, 8s8i:l
2	8pj1:s	159	138	0.5769	0.4717	0.5435	5.38e-44	7a09:4, 8oz0:U, 8ppl:Is, 7qp6:s, 6ybv:s, 6zmw:s, 6zp4:4
3	2d74:B	137	131	0.3385	0.3212	0.3359	3.62e-28	2dcu:B
4	2qmu:C	132	125	0.3385	0.3333	0.3520	1.70e-23	5jb3:8
5	1nee:A	135	125	0.2923	0.2815	0.3040	1.88e-23
6	7ase:n	225	140	0.3385	0.1956	0.3143	1.31e-14
7	8cas:m	147	112	0.2769	0.2449	0.3214	1.57e-12	6fyx:m, 6fyy:m, 8s8j:m, 6zu9:m
8	2e9h:A	157	97	0.2154	0.1783	0.2887	2.42e-10	8oz0:H, 8pj2:z, 8pj3:z
9	1k81:A	36	33	0.0769	0.2778	0.3030	0.094
10	7bhp:A	322	51	0.1462	0.0590	0.3725	1.6
11	6uss:A	485	35	0.1000	0.0268	0.3714	4.2	6uss:B
12	6m5x:O	334	66	0.1615	0.0629	0.3182	4.5	6m5x:R, 6m5x:P, 6m5x:Q
13	7pfo:B	759	53	0.1231	0.0211	0.3019	4.7	7plo:B, 5vbn:B, 5vbn:F
14	4c91:A	811	68	0.1538	0.0247	0.2941	4.8
15	4hca:A	99	38	0.0923	0.1212	0.3158	5.0	4hc7:B
16	3pmq:A	593	77	0.1462	0.0320	0.2468	7.1
17	2m9w:A	63	28	0.0769	0.1587	0.3571	7.6	8vg0:T, 8vg1:T
18	6mp8:A	308	35	0.0846	0.0357	0.3143	7.9
19	8gz2:B	1174	32	0.0923	0.0102	0.3750	8.0	8gz1:B
20	8fhd:A	1294	32	0.0923	0.0093	0.3750	8.2

[Back]