VFDEYLEKSKANKELNDKKRMATSAANFARAYTVEFGSCQFPYNFTGCQDLAKQKKVPFLSDDLEIECEGKEKFKCGSNV
FWKW
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5zji:N | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 1.06e-58 | |
| 2 | 8wgh:N | 84 | 84 | 0.8452 | 0.8452 | 0.8452 | 9.58e-50 | |
| 3 | 7yca:N | 91 | 67 | 0.4524 | 0.4176 | 0.5672 | 8.93e-22 | |
| 4 | 7msc:Y | 68 | 36 | 0.1548 | 0.1912 | 0.3611 | 2.3 | 7f0d:Y, 7kgb:Y, 7msh:Y, 7msm:Y, 7msz:Y, 7mt2:Y, 7mt3:Y, 7mt7:Y, 7sfr:Y, 5v7q:Y, 5v93:Y |
umich.edu