VESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGA
TTDTTVLEANAVLLGIQE
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8csp:W | 98 | 98 | 1.0000 | 1.0000 | 1.0000 | 1.06e-69 | 8csq:W |
2 | 2rg4:A | 206 | 33 | 0.1327 | 0.0631 | 0.3939 | 0.79 | 2rg4:B |
3 | 2p6r:A | 683 | 49 | 0.1531 | 0.0220 | 0.3061 | 1.9 | |
4 | 2x0q:A | 582 | 28 | 0.0714 | 0.0120 | 0.2500 | 4.8 | 2x0p:A |