Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
VDVEDVPSAEWGWSHMPIGVMHIGGLLSAAFLLVMMRGNHVGHVEDWFLIGFAAVIVALVGRNWWLRRRGWIR

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6adq:D 92 73 1.0000 0.7935 1.0000 1.48e-47 6adq:P, 8ovc:P, 8ovc:I, 8ovd:P, 8ovd:I, 7rh5:P, 7rh5:J, 7rh6:J, 7rh6:P, 7rh7:P, 7rh7:J
2 7qhm:I 135 61 0.3151 0.1704 0.3770 2.62e-06 7q21:H, 7q21:h, 7qhm:V, 7qho:I, 7qho:V
3 8adl:B 801 19 0.1233 0.0112 0.4737 2.9 8adl:G, 8adl:O, 8adl:J
4 6ko5:A 398 16 0.1233 0.0226 0.5625 3.3 7f9y:R, 7f9z:R, 7na7:R, 7na8:R, 7w2z:R
5 6tvk:AAA 660 18 0.0822 0.0091 0.3333 5.0
6 2vfr:A 418 49 0.2192 0.0383 0.3265 5.1 2vfs:A, 2vft:A, 2vfu:A, 2vfv:A
7 4ptv:A 445 23 0.1507 0.0247 0.4783 5.4 4ptv:B, 4ptw:A, 4ptw:B, 4ptx:A, 4ptx:B
8 4ipn:E 463 13 0.1096 0.0173 0.6154 7.3 4ipn:B
9 7e7q:A 1958 24 0.1507 0.0056 0.4583 7.5
10 7e7o:A 2003 24 0.1507 0.0055 0.4583 7.5 7lkp:A
11 7uhy:D 288 30 0.1233 0.0312 0.3000 9.1
12 7t4p:B 241 34 0.1370 0.0415 0.2941 9.2 7t4p:F, 7t4p:J

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218