VDASRLFGESPDVVGIKKMLEKGKQWEAIQPYFDNVVREAKNFLEWSPNKRLANAVTVAAYLTSQGLILDMARTTELKVK
IKDDLVKMRYLLAYTVGKATGQSKYSLDAFHRILDPMLEVLMGSPKKENFEKFYDFLQAVVAYHKFFGGG
The query sequence (length=150) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6mur:B | 162 | 162 | 1.0000 | 0.9259 | 0.9259 | 6.26e-105 | 6mus:B, 6o7e:B, 6o7h:B, 6o7i:B |
2 | 6mus:J | 121 | 123 | 0.7600 | 0.9421 | 0.9268 | 2.94e-79 | |
3 | 6nud:A | 108 | 34 | 0.0867 | 0.1204 | 0.3824 | 0.013 | 6nud:B |
4 | 6ifk:D | 121 | 32 | 0.0800 | 0.0992 | 0.3750 | 0.15 | 6ifk:C, 6ifl:B, 6ifl:C, 6ifr:D, 6ifr:C, 6ifu:B, 6ifu:C, 6ify:D, 6ify:C, 6ifz:D, 6ifz:C, 6ig0:D, 6ig0:C |
5 | 7zc0:AAA | 710 | 65 | 0.1533 | 0.0324 | 0.3538 | 0.68 | |
6 | 6xn3:C | 139 | 75 | 0.1267 | 0.1367 | 0.2533 | 1.3 | 9ash:D, 9asi:D, 9asi:E, 9asi:C, 6xn3:D, 6xn3:E, 6xn4:C, 6xn4:D, 6xn7:C, 6xn7:D, 6xn7:E |
7 | 8rw1:j | 267 | 35 | 0.0933 | 0.0524 | 0.4000 | 2.3 | 8cas:j, 6fyx:j, 6fyy:j, 6gsm:j, 6gsn:j, 3j81:j, 3jap:j, 8s8d:j, 8s8e:j, 8s8f:j, 8s8g:j, 8s8h:j, 8s8i:j, 8s8j:j |
8 | 1kc7:A | 872 | 47 | 0.0933 | 0.0161 | 0.2979 | 2.4 | |
9 | 6t6f:A | 288 | 71 | 0.1200 | 0.0625 | 0.2535 | 3.1 | 8bfm:A, 8bfs:A, 2jc6:A, 2jc6:C, 6t28:AAA, 6t29:AAA, 6t6f:B |
10 | 6k31:A | 1109 | 64 | 0.1267 | 0.0171 | 0.2969 | 4.2 | 6k31:B |
11 | 7cpx:A | 2262 | 47 | 0.1067 | 0.0071 | 0.3404 | 4.9 | 7cpx:B, 7cpy:A, 7cpy:B |
12 | 4eb5:A | 379 | 41 | 0.1000 | 0.0396 | 0.3659 | 6.0 | 4eb5:B, 4eb7:A, 4eb7:B, 4hvk:A, 4r5f:A |
13 | 1af6:A | 421 | 27 | 0.0667 | 0.0238 | 0.3704 | 6.2 | 1af6:B, 1af6:C, 1mpm:A, 1mpm:B, 1mpm:C, 1mpn:A, 1mpn:B, 1mpn:C, 1mpo:A, 1mpo:B, 1mpo:C, 1mpq:A, 1mpq:B, 1mpq:C |