VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1b7v:A | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 1.19e-45 | 1c75:A, 1k3g:A, 1k3h:A, 1n9c:A |
2 | 6tp9:A | 85 | 66 | 0.2817 | 0.2353 | 0.3030 | 0.008 | 6tp9:C, 6tp9:B, 6tp9:F, 6tp9:D, 6tp9:J, 6tp9:E, 6tp9:K, 6tp9:G, 6tp9:H, 6tp9:I |
3 | 3a9f:A | 78 | 68 | 0.2394 | 0.2179 | 0.2500 | 0.028 | 3a9f:B |
4 | 7o38:A | 81 | 81 | 0.3521 | 0.3086 | 0.3086 | 0.029 | |
5 | 4gyd:A | 86 | 75 | 0.3380 | 0.2791 | 0.3200 | 0.085 | 4gyd:B, 4gyd:C, 4gyd:D, 4gyd:E, 4gyd:F, 4h0j:A, 4h0j:B, 4h0j:C, 4h0j:D, 4h0j:E, 4h0j:F, 4h0k:A, 4h0k:B |
6 | 2dge:A | 102 | 54 | 0.2394 | 0.1667 | 0.3148 | 0.14 | 2ce0:A, 2ce1:A, 2dge:C, 2dge:B, 2dge:D, 2v07:A |
7 | 6rtd:B | 466 | 46 | 0.1831 | 0.0279 | 0.2826 | 0.42 | 6rtd:A, 6rte:A, 6rte:B |
8 | 4v2k:A | 235 | 21 | 0.1408 | 0.0426 | 0.4762 | 0.49 | 4wq7:A, 4wq8:A, 4wq9:A, 4wqa:A, 4wqb:A, 4wqc:A, 4wqd:A, 4wqe:A |
9 | 3dr0:A | 93 | 44 | 0.2394 | 0.1828 | 0.3864 | 0.56 | 3dr0:B, 3dr0:C, 4eic:A, 4eid:A |
10 | 6xkw:p | 254 | 70 | 0.3099 | 0.0866 | 0.3143 | 2.5 | 6xkx:p, 6xkz:p |
11 | 4djd:D | 323 | 30 | 0.1549 | 0.0341 | 0.3667 | 4.6 | 4djd:F |
12 | 6hwh:i | 162 | 16 | 0.0986 | 0.0432 | 0.4375 | 6.1 | 6hwh:j |
13 | 1jda:A | 418 | 29 | 0.1690 | 0.0287 | 0.4138 | 6.4 | 2amg:A, 1gcy:A, 6iwk:A, 6iyg:A, 6j3x:A, 1jdc:A, 1jdd:A, 6jqb:A, 1qi3:A, 1qi4:A, 1qi5:A, 1qpk:A |
14 | 6adq:C | 223 | 16 | 0.0986 | 0.0314 | 0.4375 | 6.5 | 6adq:O, 6hwh:M, 6hwh:K, 8ovc:O, 8ovc:C, 8ovd:O, 8ovd:C, 7rh5:O, 7rh5:I, 7rh6:O, 7rh6:I, 7rh7:O, 7rh7:I |
15 | 3sky:A | 261 | 34 | 0.1831 | 0.0498 | 0.3824 | 8.5 | |
16 | 7o9u:A | 153 | 53 | 0.1972 | 0.0915 | 0.2642 | 8.7 | |
17 | 7am2:BK | 694 | 22 | 0.1408 | 0.0144 | 0.4545 | 9.0 | |
18 | 6p4f:C | 436 | 13 | 0.1268 | 0.0206 | 0.6923 | 9.1 | 6p4f:A, 6p4w:A |