TYKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLEALKMGKLDAFLAEANQDKFTLTDAFPFQFGPFLPKPIGYPQF
LALENVDDYLNGELFENEEHAVIDTVTKNQPHKDDNLYQVATTRFSNDTSLYVIANESDLLNELMSSLQYSGLGGKRSSG
FGRFELDIQNIPLELSDRLTKNHSDKVMSLTTALPVDADLEEAMEDGHYLLTKSSGFAFSHATNENYRKQDLYKFASGST
FSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKL
The query sequence (length=272) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ifl:G | 273 | 273 | 1.0000 | 0.9963 | 0.9963 | 0.0 | 6ifu:G |
2 | 6ifn:B | 297 | 296 | 1.0000 | 0.9158 | 0.9189 | 0.0 | 6ifk:B, 6ifr:B, 6ify:B, 6ifz:B, 6ig0:B, 6nud:I, 6nue:I |
3 | 9ash:B | 297 | 291 | 0.4191 | 0.3838 | 0.3918 | 3.69e-42 | 9asi:B, 6xn5:B |
4 | 6xn7:B | 277 | 277 | 0.4081 | 0.4007 | 0.4007 | 6.12e-42 | 6xn3:B, 6xn4:B |
5 | 7v01:H | 297 | 303 | 0.3640 | 0.3333 | 0.3267 | 1.33e-38 | 8do6:B, 7uzw:H, 7uzx:H, 7uzy:H, 7uzz:H, 7v00:H, 7v02:H |
6 | 8wfx:M | 296 | 305 | 0.3824 | 0.3514 | 0.3410 | 1.97e-36 | |
7 | 6mur:E | 286 | 145 | 0.1176 | 0.1119 | 0.2207 | 0.23 | 6iqw:E, 6mus:E, 6mut:E, 6muu:E, 6o7e:E, 6o7h:E, 6o7i:E |
8 | 2j68:A | 680 | 57 | 0.0772 | 0.0309 | 0.3684 | 1.2 | 2w6d:A, 2w6d:B |
9 | 8hg5:Q | 225 | 50 | 0.0625 | 0.0756 | 0.3400 | 1.4 | 7yca:Q |
10 | 5om9:A | 396 | 20 | 0.0368 | 0.0253 | 0.5000 | 4.4 | 3fju:A, 6i6z:A, 6i6z:B, 5om9:B, 4uee:A, 4uee:B, 4uez:A, 4uez:B, 2v77:A, 2v77:B |
11 | 2p88:A | 369 | 179 | 0.1324 | 0.0976 | 0.2011 | 4.7 | 2p88:B, 2p88:C, 2p88:D, 2p88:E, 2p88:F, 2p88:G, 2p88:H, 2p8b:A, 2p8c:A |
12 | 3bdv:A | 191 | 62 | 0.0772 | 0.1099 | 0.3387 | 6.8 | |
13 | 5eke:C | 307 | 62 | 0.0588 | 0.0521 | 0.2581 | 7.0 | 5eke:A, 5eke:B, 5eke:D, 5ekp:C, 5ekp:A, 5ekp:B, 5ekp:D |
14 | 7rj1:A | 265 | 65 | 0.0735 | 0.0755 | 0.3077 | 9.1 | 7rj1:B, 7rj1:C, 7rj1:D |
15 | 3uxy:C | 241 | 71 | 0.0699 | 0.0788 | 0.2676 | 9.7 | |
16 | 3m6w:A | 460 | 79 | 0.0882 | 0.0522 | 0.3038 | 9.8 | 3m6v:A, 3m6v:B |