TVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALQVGHLKVTMIAWLDELLGGPWDEAYWDR
RYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGKVLDLELAVMLHTYR
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ohe:F | 155 | 152 | 1.0000 | 0.9484 | 0.9671 | 9.83e-103 | 5ohe:A, 5ohe:B, 5ohe:C, 5ohe:D, 5ohe:E, 5ohe:G, 5ohe:H, 5ohf:A, 5ohf:B, 5ohf:C, 5ohf:D, 5ohf:E, 5ohf:F, 5ohf:G, 5ohf:H, 6otd:A |
2 | 2w31:A | 152 | 150 | 0.3605 | 0.3487 | 0.3533 | 1.09e-20 | 2w31:B |
3 | 8h17:A | 157 | 138 | 0.2925 | 0.2739 | 0.3116 | 4.27e-10 | |
4 | 1or4:A | 169 | 142 | 0.2721 | 0.2367 | 0.2817 | 1.59e-08 | 1or4:B, 1or6:A, 1or6:B |
5 | 6m9a:C | 157 | 71 | 0.1429 | 0.1338 | 0.2958 | 1.3 | 6i2z:A, 6i2z:B, 6m9a:A, 6m9a:B, 4uiq:A, 4uiq:B |
6 | 6nrq:B | 104 | 32 | 0.0680 | 0.0962 | 0.3125 | 1.5 | |
7 | 8zfk:D | 412 | 54 | 0.0884 | 0.0316 | 0.2407 | 2.0 | 8zfk:E, 8zfk:A, 8zfk:B, 8zfk:C |
8 | 2j07:A | 419 | 59 | 0.1497 | 0.0525 | 0.3729 | 3.1 | 1iqr:A, 1iqu:A, 2j08:A, 2j09:A |
9 | 1rrv:A | 401 | 24 | 0.0748 | 0.0274 | 0.4583 | 6.0 | 1rrv:B |
10 | 7ui4:A | 413 | 32 | 0.0884 | 0.0315 | 0.4062 | 6.4 | |
11 | 3nio:A | 316 | 84 | 0.1769 | 0.0823 | 0.3095 | 9.8 | 3nio:B, 3nio:C, 3nio:D, 3nio:E, 3nio:F |