BioLiP

>protein
TVDPNRAAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAHWFG

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2m48:A	141	73	1.0000	0.5177	1.0000	1.84e-50	9c5e:A, 2lwr:A
2	5caw:C	315	72	0.7123	0.1651	0.7222	4.98e-35	5caw:A
3	4zyn:B	385	71	0.5753	0.1091	0.5915	2.39e-25	4k7d:A, 4k7d:B, 4k7d:C, 4k95:A, 4k95:B, 4k95:C, 4k95:D, 4k95:E, 4k95:F, 4k95:G, 4k95:H, 4k95:I, 4k95:J, 4k95:K, 4k95:L, 7us1:A, 8w31:A, 4zyn:A
4	6n13:B	322	71	0.5616	0.1273	0.5775	2.11e-24	2jmo:A
5	5c1z:A	384	71	0.4932	0.0938	0.5070	3.43e-19	4bm9:A, 5c1z:B, 5c23:A, 5c23:B, 5c9v:A, 6glc:A, 6hue:A, 6hue:B, 4i1f:A, 4i1h:A, 8ik6:C, 8ikm:A, 8ikt:A, 8ikv:C, 8ikv:A, 8jwv:A, 5n2w:A, 5n38:A, 8wzn:A, 8wzo:A
6	8ik6:A	250	71	0.4932	0.1440	0.5070	4.18e-19
7	5tte:B	442	60	0.3562	0.0588	0.4333	2.94e-11	7b5m:H, 2m9y:A, 1wd2:A
8	7b5l:H	423	60	0.3562	0.0615	0.4333	3.17e-11	7b5n:H, 4kc9:A, 5udh:A
9	4kbl:A	395	53	0.3425	0.0633	0.4717	5.44e-11	4kbl:B, 5udh:B
10	7od1:A	430	50	0.2740	0.0465	0.4000	6.54e-08	7od1:B
11	8s4g:S	102	66	0.3425	0.2451	0.3788	2.44e-06	9gaw:S, 2m6n:A, 7qe7:S
12	2rt9:A	52	40	0.1781	0.2500	0.3250	1.31e-04
13	1ee8:A	266	36	0.1918	0.0526	0.3889	0.34	1ee8:B
14	6ddt:A	862	29	0.1507	0.0128	0.3793	0.92	6ddu:A
15	7t92:C	317	16	0.0959	0.0221	0.4375	2.7
16	1syo:A	422	35	0.1507	0.0261	0.3143	5.8	1syo:B, 1sz0:A, 1sz0:B
17	6znl:Y	410	30	0.1644	0.0293	0.4000	6.0	7z8m:Y, 6znm:Y, 6znn:Y, 6zno:Y, 6zo4:Y
18	6sc6:A	365	37	0.1918	0.0384	0.3784	6.1	5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C
19	1h3f:B	406	18	0.1507	0.0271	0.6111	6.7	1h3f:A
20	8tao:B	771	47	0.1781	0.0169	0.2766	6.9	7fd8:A, 7fd8:B, 7fd9:A, 7fd9:B, 3lmk:A, 3lmk:B, 8t8m:A
21	8pr4:Y	375	30	0.1644	0.0320	0.4000	6.9
22	2f5q:A	273	34	0.1644	0.0440	0.3529	7.0	2f5p:A, 2f5s:A, 4g4q:A, 3gpy:A, 3gq4:A, 3jr4:A, 3jr5:A, 1l1t:A, 1l1z:A, 1l2b:A, 1l2c:A, 1l2d:A, 1r2y:A, 1r2z:A
23	4g4n:A	253	34	0.1644	0.0474	0.3529	7.1	2f5n:A, 2f5o:A, 4g4o:A, 4g4r:A, 3go8:A, 3gp1:A, 3gpp:A, 3gpu:A, 3gpx:A, 3gq3:A, 3gq5:A, 3sar:A, 3sas:A, 3sat:A, 3sau:A, 3sav:A, 3saw:A, 3sbj:A, 3u6c:A, 3u6d:A, 3u6e:A, 3u6l:A, 3u6m:A, 3u6o:A, 3u6p:A, 3u6q:A, 3u6s:A
24	6n51:B	793	47	0.1781	0.0164	0.2766	7.3	6n4x:B, 6n4y:C, 6n50:A, 6n50:B, 6n50:C, 6n51:A, 8t6j:B, 8t6j:A, 8t7h:A, 8t7h:B, 8t8m:B, 8tao:A

[Back]