TTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDITTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVET
IGTRDAIESVYDVRVLNVTPEHTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRVDAPTRANAPLV
SFDETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVREGYPSIGCAPCTAKPA
The query sequence (length=214) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7lhr:A | 214 | 214 | 0.9953 | 0.9953 | 0.9953 | 2.85e-156 | 7lhr:B, 7lhs:A, 7lhs:B, 7lhu:A, 7lhu:B |
2 | 2goy:B | 223 | 203 | 0.3411 | 0.3274 | 0.3596 | 4.94e-27 | 2goy:A, 2goy:C, 2goy:D, 2goy:E, 2goy:F, 2goy:G, 2goy:H |
3 | 2oq2:C | 257 | 198 | 0.2477 | 0.2062 | 0.2677 | 3.80e-14 | 2oq2:A, 2oq2:B, 2oq2:D |
4 | 2byc:A | 137 | 89 | 0.1308 | 0.2044 | 0.3146 | 0.026 | 2byc:B |
5 | 1zun:A | 204 | 174 | 0.1963 | 0.2059 | 0.2414 | 0.11 | |
6 | 8rom:A | 194 | 66 | 0.0888 | 0.0979 | 0.2879 | 0.43 | |
7 | 8a25:A | 289 | 47 | 0.0841 | 0.0623 | 0.3830 | 0.94 | 8a26:A |
8 | 7v3x:V | 437 | 68 | 0.0888 | 0.0435 | 0.2794 | 1.9 | 7v3x:U |
9 | 1f47:B | 144 | 57 | 0.0654 | 0.0972 | 0.2456 | 2.0 | 1s1j:A, 1s1s:B, 1y2f:A, 1y2g:A |
10 | 8wfx:N | 265 | 82 | 0.1075 | 0.0868 | 0.2805 | 2.7 | |
11 | 5lqw:A | 2130 | 75 | 0.1028 | 0.0103 | 0.2933 | 4.1 | |
12 | 7eqx:C | 299 | 88 | 0.1215 | 0.0870 | 0.2955 | 6.8 | 7eqx:D, 7eqz:A |
13 | 7tei:B | 1042 | 36 | 0.0561 | 0.0115 | 0.3333 | 7.1 |