TTCKEDFANKNYTIITSRCKGPNYPANVCCSAFKDFACPFAEVLNDEKNDCASTMFSYINLYGRYPPGIFANMCKEGKEG
LDCT
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6a5e:C | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 1.25e-58 | 6a5e:D |
2 | 6a5d:B | 93 | 82 | 0.6905 | 0.6237 | 0.7073 | 7.47e-40 | 6a5d:A |
3 | 6czs:A | 312 | 63 | 0.2143 | 0.0577 | 0.2857 | 2.4 | 1nb3:A, 1nb3:B, 1nb3:C, 1nb3:D, 1nb5:A, 1nb5:B, 1nb5:C, 1nb5:D, 8pch:A |
4 | 7yfr:A | 691 | 47 | 0.1905 | 0.0232 | 0.3404 | 3.2 | 7yfr:C |
5 | 4lcc:C | 341 | 22 | 0.1310 | 0.0323 | 0.5000 | 3.5 | |
6 | 5ah1:A | 427 | 19 | 0.1190 | 0.0234 | 0.5263 | 3.8 | |
7 | 5l5u:A | 250 | 29 | 0.1548 | 0.0520 | 0.4483 | 5.7 | 5l5x:A, 5l60:A, 5l61:A, 5l62:A, 5l63:A, 5l64:A |
8 | 5ixo:A | 596 | 28 | 0.1429 | 0.0201 | 0.4286 | 7.4 | 5ixq:A, 5ixt:A, 5iyv:A, 5iyx:A |
9 | 3pym:A | 332 | 31 | 0.1786 | 0.0452 | 0.4839 | 7.5 | 3pym:B |
10 | 7zm7:B | 456 | 12 | 0.0952 | 0.0175 | 0.6667 | 8.5 | 7zmb:B, 7zmg:B |