TSVDCTAYGPELRALAARLPRTPRADLYAFLDAAHTAAASLPGALATALDTFNAEGSEDGHLLLRGLPVEADADLPTTPS
STPAPEDRSLLTMEAMLGLVGRRLGLHTGYRELRSGTVYHDVYPSPGAHHLSSETSETLLEFHTEMAYHRLQPNYVMLAC
SRADHERTAATLVASVRKALPLLDERTRARLLDRRMPCCVDVAFRGIAQVKPLYGDADDPFLGYDRELLAPEDPADKEAV
AALSKALDEVTEAVYLEPGDLLIVDNFRTTHARTPFSPRWDGKDRWLHRVYIRTDRNGQLSGGERAGDVVAFTPRG
The query sequence (length=316) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ds1:A | 323 | 323 | 1.0000 | 0.9783 | 0.9783 | 0.0 | 1drt:A, 1dry:A, 1gvg:A |
2 | 6vwq:A | 325 | 319 | 0.8133 | 0.7908 | 0.8056 | 0.0 | 6vwr:A |
3 | 2og6:A | 323 | 278 | 0.3070 | 0.3003 | 0.3489 | 1.37e-37 | 2og7:A |
4 | 6f2a:C | 326 | 281 | 0.2658 | 0.2577 | 0.2989 | 3.12e-26 | 6f2a:A, 6f2a:B, 6f2a:D, 6f2b:A, 6f2b:B, 6f2b:C, 6f2b:D, 6f6j:A, 6f6j:B, 6f6j:C, 6f6j:D |
5 | 6daw:A | 342 | 304 | 0.2880 | 0.2661 | 0.2993 | 1.24e-20 | 6daw:B |
6 | 6alm:A | 338 | 299 | 0.3196 | 0.2988 | 0.3378 | 1.03e-17 | 6aln:A, 6alo:A, 6alp:A, 6alq:A, 6alr:A, 6dax:A, 6daz:A, 6db2:A, 9eqf:A, 6mp9:A, 2wbo:A, 2wbp:A, 2wbq:A, 6y0n:A, 6y12:A |
7 | 6mp8:A | 308 | 277 | 0.3006 | 0.3084 | 0.3430 | 5.08e-17 | |
8 | 4m25:B | 317 | 270 | 0.2627 | 0.2618 | 0.3074 | 8.47e-17 | 4m25:C, 4m25:D, 4m26:B, 4m27:B, 4m2f:B, 4m2g:B, 4m2i:B, 4m2i:C, 4m2i:D, 4ne0:B, 4ne0:D |
9 | 4ne0:A | 337 | 284 | 0.2595 | 0.2433 | 0.2887 | 6.49e-15 | 4m25:A, 4m26:A, 4m26:C, 4m26:D, 4m27:A, 4m27:C, 4m27:D, 4m2c:B, 4m2c:C, 4m2c:D, 4m2e:B, 4m2e:C, 4m2e:D, 4m2f:A, 4m2f:C, 4m2f:D, 4m2g:A, 4m2g:C, 4m2g:D, 4m2i:A, 4ne0:C |
10 | 7y5f:B | 341 | 253 | 0.2532 | 0.2346 | 0.3162 | 7.02e-13 | 7vgn:A, 7y5f:A, 7y5i:A, 7y5i:B, 7y5p:A, 7y5p:B, 7yhe:A, 7yhe:B, 7yw9:A |
11 | 6euo:C | 354 | 180 | 0.1487 | 0.1328 | 0.2611 | 0.002 | 6euo:A, 6euo:B, 6euo:D, 6eur:A, 6eur:C, 6eur:D, 6exf:A, 6exf:C, 6exf:D, 6exh:A, 6exh:B, 6exh:C, 6exh:D, 6f9p:A, 6f9p:C, 6f9p:D |
12 | 6npb:B | 378 | 177 | 0.1551 | 0.1296 | 0.2768 | 0.007 | 6npb:A, 6npc:A, 6npc:B, 6npd:A, 6npd:B |
13 | 2q4a:B | 322 | 34 | 0.0443 | 0.0435 | 0.4118 | 0.16 | 2q4a:A, 1y0z:A, 1y0z:B |
14 | 6f9p:B | 289 | 197 | 0.1582 | 0.1730 | 0.2538 | 0.36 | |
15 | 2vqd:A | 447 | 84 | 0.0601 | 0.0425 | 0.2262 | 1.1 | |
16 | 7tcl:X | 259 | 39 | 0.0443 | 0.0541 | 0.3590 | 1.3 | |
17 | 1nx4:C | 250 | 23 | 0.0380 | 0.0480 | 0.5217 | 2.2 | 1nx4:A, 1nx8:A, 1nx8:C |
18 | 4oj8:B | 271 | 23 | 0.0380 | 0.0443 | 0.5217 | 2.4 | 1nx4:B, 1nx8:B, 4oj8:A, 4oj8:C |
19 | 7msk:A | 421 | 82 | 0.0791 | 0.0594 | 0.3049 | 2.9 | 7msk:B |
20 | 1jr7:A | 306 | 62 | 0.0506 | 0.0523 | 0.2581 | 8.1 | 8cdf:A, 6gpe:A, 6gpe:B, 6gpn:A, 6gpn:B, 6hl8:A, 6hl8:B, 6hl9:A, 6hl9:B, 2r6s:A |