BioLiP

>protein
TQPSDWAYIAEHIVFSYQGQSKTRALRVRNDVSGQWRRNILPKLVPRQLLTTSREVTLEEGWYKELLRRGVLLEDLTSNV
DDDGAITVAIEIKPKWGFLPCAGHLQPPESVSIKSHVSRFRLHQHFRGRADDPPYDPLDLFSGDKMRMRTALDGLWTMWE
ISRGKSNNWKVFIGSKEISPDDLQRGLLPMGGDDLVTNITQLTLSALQTSSALPLLKNLQQNLDPIDISSLAALFQAEHP
NSPIFDPDLIAEVSAVELNSFVDIYISDPQAGQRMDSWSLRERIIAYALSAIFKDCSLFVRGVLKHAEDGAWRLVSGGES
VKVIDLDLKPVKNIQKWAETDEKVWKHWLKTKGT

The query sequence (length=354) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xu6:C	379	372	1.0000	0.9340	0.9516	0.0	5xu6:A, 5xu6:B, 5xu6:D
2	6fl3:B	420	293	0.2119	0.1786	0.2560	2.75e-13	4axc:A, 4axf:A, 6fjk:B, 6fl8:B, 6gfg:B, 6gfg:A, 6gfh:A, 6gfh:B, 4lv7:B, 3udt:A, 3udt:B, 3udz:A, 3udz:B, 2xan:A, 2xao:A
3	4axd:A	433	299	0.2260	0.1848	0.2676	1.21e-12	4aqk:A, 4axe:A, 6fjk:A, 6fl3:A, 6fl8:A, 2xal:A, 2xal:B, 2xam:A, 2xam:B, 2xan:B, 2xao:B, 2xar:A, 2xar:B
4	4lv7:A	390	424	0.3023	0.2744	0.2524	2.84e-12	3uds:A, 3uds:B
5	5mwl:A	421	316	0.2232	0.1876	0.2500	2.19e-10	5mw8:A, 5mwl:B, 5mwm:A
6	4xz6:A	291	165	0.1130	0.1375	0.2424	0.71	4xz6:B
7	4b45:A	334	41	0.0395	0.0419	0.3415	2.8
8	6b9t:D	453	62	0.0480	0.0375	0.2742	4.8	6b9s:A, 6b9s:D, 6b9s:C, 6b9s:G, 6b9s:E, 6b9t:A, 6b9t:B, 6b9t:C, 6b9t:E, 6b9t:F, 6b9t:G, 6b9t:H
9	1kkt:A	475	28	0.0282	0.0211	0.3571	6.7	1kre:B, 1kre:A, 1krf:A, 1krf:B, 2ri9:A, 2ri9:B
10	2glf:A	450	57	0.0537	0.0422	0.3333	7.8	2glf:B, 2glf:C, 2glf:D
11	5tpk:A	202	35	0.0452	0.0792	0.4571	9.3

[Back]