TNRNARPPKKANHGARPCSSVMRRLKKKYFYRRTKEAMTPEMEPKKKFEL
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6z1p:AQ | 50 | 50 | 1.0000 | 1.0000 | 1.0000 | 3.43e-31 | |
| 2 | 6xa3:A | 409 | 31 | 0.2200 | 0.0269 | 0.3548 | 4.4 | 6xa2:A, 6xa2:B, 6xa2:C, 6xa2:D, 6xa2:E, 6xa2:F, 6xa2:G, 6xa2:H |
| 3 | 7jms:C | 159 | 32 | 0.2000 | 0.0629 | 0.3125 | 7.0 | 7jms:A, 7jms:E, 7jms:G |
zhanggroup.org