TLYGLMAEFDDAEALLAAAEKTRDAGYKQFEAYTPMPIHGLDEAVGYRGTRLPWVIFGAGLLGASGMFALQTWINLVEYP
LNIGGRPLFSWPAFIPATFEGMVLLSAFAAVFGMIAACGLPRPYHPVFNAPNFERASVDRFFLCIEAADPKFELKQTRQF
LESLGPLAVSTVDN
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6loe:D | 174 | 174 | 1.0000 | 1.0000 | 1.0000 | 1.02e-127 | |
2 | 8k9e:D | 175 | 173 | 0.5230 | 0.5200 | 0.5260 | 6.63e-59 | 8k9f:D, 8x2j:D |
3 | 7jqh:A | 313 | 53 | 0.1264 | 0.0703 | 0.4151 | 0.011 | 7jqi:A, 7jqj:A, 6ovl:A, 6oxn:A, 6p35:A |
4 | 3kbo:A | 312 | 102 | 0.1782 | 0.0994 | 0.3039 | 0.50 | 3kbo:B, 3kbo:C, 3kbo:D |
5 | 7p6l:B | 458 | 57 | 0.0977 | 0.0371 | 0.2982 | 5.0 | 7p6l:A, 7p6l:C, 7p6l:D |
6 | 3w9z:A | 290 | 43 | 0.0747 | 0.0448 | 0.3023 | 7.4 | |
7 | 4bf9:A | 318 | 43 | 0.0747 | 0.0409 | 0.3023 | 7.6 | 4bfa:A, 4bfa:B, 4yco:A, 4yco:B, 4yco:C, 4ycp:A |
8 | 7ne2:D | 292 | 60 | 0.0920 | 0.0548 | 0.2667 | 8.3 | 7ne2:A, 7ne2:B, 7ne2:C |