TLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFS
PRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGL
YDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPK
The query sequence (length=239) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ezg:A | 275 | 245 | 0.9623 | 0.8364 | 0.9388 | 2.32e-168 | 7f1e:A, 7f1e:B, 8owx:A, 8owx:B, 8p7b:A, 8p7c:A, 8p7c:C, 8p7d:A |
2 | 8owy:A | 172 | 223 | 0.7197 | 1.0000 | 0.7713 | 2.84e-114 | 8owy:B |
3 | 8joz:A | 257 | 133 | 0.1590 | 0.1479 | 0.2857 | 2.29e-05 | 4htf:A, 4htf:B |
4 | 7clf:A | 335 | 107 | 0.1130 | 0.0806 | 0.2523 | 1.08e-04 | 7clf:B |
5 | 5wp4:A | 485 | 180 | 0.1925 | 0.0948 | 0.2556 | 5.59e-04 | |
6 | 6orr:C | 273 | 88 | 0.0962 | 0.0842 | 0.2614 | 0.004 | 7bkg:A, 7bkg:B, 7bkg:C, 7bkg:D, 7ble:A, 7ble:B, 7ble:C, 7ble:D, 6chh:A, 6chh:B, 6chh:C, 6chh:D, 7egu:A, 7ehz:A, 7ei2:A, 7et7:A, 7et7:B, 7et7:C, 7et7:D, 7eu5:A, 7eu5:B, 7eu5:C, 7eu5:D, 2iip:A, 2iip:B, 2iip:C, 2iip:D, 7nbj:A, 7nbj:B, 7nbj:C, 7nbj:D, 7nbm:A, 7nbm:B, 7nbm:C, 7nbm:D, 7nbq:A, 7nbq:B, 7nbq:C, 7nbq:D, 6orr:A, 6orr:B, 6orr:D, 6pve:A, 6pve:B, 6pve:C, 6pve:D, 6pvs:A, 6pvs:B, 6pvs:C, 6pvs:D, 7rkk:A, 7rkk:B, 7rkl:A, 7rkl:B, 7rkl:C, 7rkl:D, 3rod:A, 3rod:B, 3rod:C, 3rod:D, 7sok:C, 7sok:A, 7sok:B, 7sok:D, 7wmc:A, 7wmc:B, 7wmt:A, 5xvq:A, 5xvq:B, 5yjf:A, 5yjf:B, 5yjf:C, 5yjf:D |
7 | 5f8f:B | 361 | 142 | 0.1548 | 0.1025 | 0.2606 | 0.015 | 5f8e:A, 5f8e:B, 5f8f:A, 5f8f:C |
8 | 5wp5:A | 463 | 180 | 0.1883 | 0.0972 | 0.2500 | 0.020 | 5wp5:B |
9 | 5wp5:A | 463 | 109 | 0.1130 | 0.0583 | 0.2477 | 0.074 | 5wp5:B |
10 | 5bsz:A | 247 | 92 | 0.1172 | 0.1134 | 0.3043 | 0.032 | |
11 | 2i62:B | 261 | 153 | 0.1339 | 0.1226 | 0.2092 | 0.038 | 2i62:A, 2i62:C, 2i62:D, 5xvk:A, 5xvk:B, 5yji:A, 5yji:B |
12 | 3lcc:A | 216 | 112 | 0.1172 | 0.1296 | 0.2500 | 0.042 | |
13 | 4gek:G | 231 | 106 | 0.1130 | 0.1169 | 0.2547 | 0.096 | 4gek:A, 4iwn:A, 4iwn:B |
14 | 4ine:A | 431 | 178 | 0.2008 | 0.1114 | 0.2697 | 0.36 | 4ine:B |
15 | 7wzg:B | 243 | 110 | 0.1339 | 0.1317 | 0.2909 | 0.47 | 7wzg:A, 7wzg:C, 7wzg:D, 7wzg:E, 7wzg:F |
16 | 5bp9:A | 237 | 150 | 0.1339 | 0.1350 | 0.2133 | 0.78 | |
17 | 7mqa:NL | 278 | 65 | 0.0837 | 0.0719 | 0.3077 | 1.4 | 7wts:3, 1zq9:A, 1zq9:B |
18 | 5aog:A | 307 | 52 | 0.0669 | 0.0521 | 0.3077 | 2.1 | |
19 | 4qdk:A | 219 | 41 | 0.0544 | 0.0594 | 0.3171 | 2.6 | 4qdj:A, 4qdk:B |
20 | 3jwh:A | 191 | 71 | 0.0837 | 0.1047 | 0.2817 | 2.7 | 3jwh:B |
21 | 5lfu:A | 487 | 45 | 0.0669 | 0.0329 | 0.3556 | 3.0 | 5lf5:A, 5lfr:A, 5lfr:B, 5lfv:B, 5lfv:A |
22 | 9fcx:A | 214 | 101 | 0.1172 | 0.1308 | 0.2772 | 4.0 | 9fcd:A, 9fcl:A, 9fcq:A, 9fcs:A, 9fcs:B, 9fcu:A, 9fcu:B, 9fcu:C, 9fcu:D, 9fcx:B, 9fcy:A, 9fcy:B, 9fcy:C, 9fcy:D, 9fd3:A, 9g0k:A, 9g0k:B |
23 | 1qzz:A | 340 | 131 | 0.1423 | 0.1000 | 0.2595 | 4.6 | 1r00:A, 1xds:A, 1xds:B, 1xdu:A |
24 | 4a6d:A | 345 | 104 | 0.1130 | 0.0783 | 0.2596 | 6.1 | 4a6e:A |
25 | 6uak:A | 297 | 104 | 0.1046 | 0.0842 | 0.2404 | 6.2 | |
26 | 7dlh:A | 302 | 34 | 0.0544 | 0.0430 | 0.3824 | 7.8 |