TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRT
The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wxe:n | 37 | 37 | 1.0000 | 1.0000 | 1.0000 | 8.60e-19 | 8wy0:n, 8wyi:n, 8yc0:n |
2 | 3u16:B | 437 | 24 | 0.2703 | 0.0229 | 0.4167 | 5.0 | 3o82:A, 3o82:B, 3o83:A, 3o83:B, 3o84:A, 3o84:B, 3u16:A, 3u17:A, 3u17:B |