TLLHAADVVLDPDTAHPELFLSEDRRSVRRGPSRQSIPDNPERFDCQPCVLGLESFSSGRHYWEVEVENVMVWAVGVCRD
SVERKGEALLVPQNGFWTLEMFGNQYRALSSPEKILPLKERLHRVGIFLDYESGDVSFYNMRDRSHIYTCPRSPFSGPLR
PFFRLGSDDSPLFICPAFIGAQGVTVPEGGLVLHRAE
The query sequence (length=197) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hjt:A | 197 | 197 | 1.0000 | 1.0000 | 1.0000 | 1.95e-146 | 8hjt:B |
2 | 8igt:A | 208 | 199 | 0.8020 | 0.7596 | 0.7940 | 4.03e-116 | 8jyc:A, 8jyc:B, 8jye:A, 8jye:B |
3 | 8jya:B | 191 | 178 | 0.5025 | 0.5183 | 0.5562 | 8.81e-66 | 8hjt:C, 8hjt:D, 8jy9:A, 8jy9:B, 8jyf:B |
4 | 6j0k:A | 191 | 178 | 0.4924 | 0.5079 | 0.5449 | 9.02e-62 | 6j0g:A, 6j0g:B, 6j0g:C, 6j0g:D, 6j0k:B |
5 | 8ixv:A | 187 | 178 | 0.4822 | 0.5080 | 0.5337 | 2.14e-60 | 8ize:A, 8izg:A, 6j06:A, 6j06:C, 6j06:B, 8jyc:C, 8jyc:D, 8jye:C, 8jye:D, 4n7u:A, 5zxk:A |
6 | 4cg4:C | 376 | 186 | 0.4619 | 0.2420 | 0.4892 | 1.34e-54 | 4cg4:D, 4cg4:E, 4cg4:F |
7 | 8pd6:A | 181 | 173 | 0.4569 | 0.4972 | 0.5202 | 3.56e-54 | |
8 | 7ovx:A | 174 | 173 | 0.3909 | 0.4425 | 0.4451 | 9.79e-42 | 8a5l:A, 8a5m:A, 8a5m:B, 8a8x:A, 8a8x:C, 7ow2:A, 7ow2:B, 7ow2:C, 7ow2:D, 8r5b:A, 8r5b:B, 8r5c:A, 7w0q:A, 7w0s:B, 7w0s:C, 7w0s:E, 7w0t:F, 7w0t:B, 7w0t:C, 7x6y:A, 7x6z:A, 7x70:A |
9 | 7xt2:B | 388 | 190 | 0.2995 | 0.1521 | 0.3105 | 6.71e-18 | 7xt2:A |
10 | 7xyz:B | 456 | 189 | 0.2741 | 0.1184 | 0.2857 | 7.56e-15 | 7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D |
11 | 4b3n:A | 557 | 144 | 0.2234 | 0.0790 | 0.3056 | 2.18e-13 | 4b3n:B |
12 | 7jhy:e | 228 | 102 | 0.1421 | 0.1228 | 0.2745 | 2.1 | 7jhy:d, 7jhy:c, 7jhy:f, 7jhy:b, 7jhy:a |
13 | 4hea:3 | 756 | 50 | 0.0711 | 0.0185 | 0.2800 | 4.8 | 2fug:3, 2fug:C, 2fug:L, 2fug:U, 4hea:D, 6i0d:3, 6i0d:D, 6i1p:3, 6i1p:D, 3i9v:3, 3i9v:C, 3iam:3, 3iam:C, 3ias:3, 3ias:C, 3ias:L, 3ias:U, 3m9s:3, 3m9s:C, 6q8o:3, 6q8o:D, 6q8w:3, 6q8w:D, 6q8x:3, 6q8x:D, 6y11:3, 6y11:D, 2ybb:3, 6ziy:3, 6zjl:3, 6zjn:3, 6zjy:3 |
14 | 4xyb:A | 384 | 54 | 0.0914 | 0.0469 | 0.3333 | 6.2 | 4xyb:B, 4xye:A, 4xye:B |
15 | 7vyx:A | 1211 | 34 | 0.0660 | 0.0107 | 0.3824 | 9.6 | 7vyx:B |