BioLiP

>protein
TIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDSGLPKVRYTQVWSHDV
TIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLGR

The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8tux:ab	127	125	0.9832	0.9213	0.9360	6.65e-79	2qux:A, 2qux:B, 2qux:E, 2qux:D, 2qux:G, 2qux:H, 2qux:J, 2qux:K, 2qux:M, 2qux:N, 2qux:P, 2qux:Q
2	6yfk:AO	137	106	0.2689	0.2336	0.3019	0.005	6yfk:BG, 6yfk:AU, 6yfk:AC
3	8hkx:AS5P	204	53	0.1597	0.0931	0.3585	0.048	8hky:AS5P, 8hkz:AS5P, 8hl1:AS5P, 8hl2:AS5P, 8hl3:AS5P, 8hl4:AS5P, 8hl5:AS5P, 8wkp:AS5P, 8wq2:AS5P, 8wq4:AS5P
4	4glr:H	229	71	0.1597	0.0830	0.2676	1.1	4glr:J
5	8opr:A	651	60	0.1345	0.0246	0.2667	1.1
6	4yo0:A	209	92	0.1849	0.1053	0.2391	5.8	4yo0:C
7	4onf:H	212	92	0.1933	0.1085	0.2500	6.2	4ong:H
8	8bn5:B	267	44	0.1261	0.0562	0.3409	6.4	8blj:A, 8blj:B, 8blj:C, 8blj:D, 8blj:E, 8blj:F, 8bn2:A, 8bn2:B, 8bn5:A
9	3seq:D	650	31	0.1176	0.0215	0.4516	6.6	3dla:B, 3seq:C, 3sez:D, 3sez:C, 3syt:D, 3szg:B
10	7pkq:o	163	48	0.1176	0.0859	0.2917	6.9
11	1azs:A	190	48	0.1513	0.0947	0.3750	9.9	3c14:A, 3c15:A, 3c16:A, 1cjk:A, 1cjt:A, 1cju:A, 1cjv:A, 1cs4:A, 1cul:A, 3g82:A, 2gvd:A, 2gvz:A, 3maa:A, 1tl7:A, 1u0h:A

[Back]