BioLiP

>protein
TIPKPSDQVPDVDAFLNKIGRNCNELKDTFENNWNNLFQWDSKILKEKGVNIQQRKYILKQVHNYRNNRPIHEIKLGKKS
FFGGERKRKAFTAKWKAEN

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8om2:2	102	99	1.0000	0.9706	1.0000	3.32e-70	8d8j:2, 8d8k:2, 8d8l:2, 5mrc:22, 5mre:22, 5mrf:22, 8om3:2, 8om4:2
2	6yw5:33	193	69	0.2626	0.1347	0.3768	2.67e-08	6ywe:33, 6ywx:33, 6ywy:33
3	6z1p:BD	107	63	0.2323	0.2150	0.3651	1.10e-04
4	6sga:Cp	178	74	0.2121	0.1180	0.2838	0.002	6hiv:Cp, 6hiw:Cp, 6hiy:Cp, 7pua:Cp, 7pub:Cp, 6sgb:Cp
5	7aor:w	175	70	0.2020	0.1143	0.2857	0.002
6	7ane:w	155	70	0.2020	0.1290	0.2857	0.009
7	8owm:C	413	102	0.2929	0.0702	0.2843	0.17	8owm:A, 8owm:B, 8owm:D, 8owm:E, 8owm:F, 8own:A, 8own:B, 8own:C, 8own:D, 8own:E, 8own:F
8	1sg9:A	274	73	0.2121	0.0766	0.2877	0.29	1nv8:A, 1nv8:B, 1nv9:A, 1sg9:B, 1sg9:C, 1vq1:A, 1vq1:B
9	4yl6:A	88	36	0.1414	0.1591	0.3889	0.75
10	6xyw:BC	68	58	0.1717	0.2500	0.2931	1.5
11	6m23:A	936	23	0.1111	0.0118	0.4783	3.9	6m23:B
12	5lzw:ii	372	56	0.1616	0.0430	0.2857	6.2	5lzx:ii, 5lzy:ii, 5lzz:ii
13	7m4v:M	119	24	0.1010	0.0840	0.4167	6.6	7m4w:M, 7m4x:M, 7m4y:M, 7m4z:M, 7ryf:M, 7ryg:M, 7ryh:M, 7uvv:M, 7uvw:M, 7uvx:M, 7uvy:M, 7uvz:M, 7uw1:M, 6v39:M, 6v3a:M, 6v3b:M, 6v3d:M, 6yhs:J, 6ysi:J
14	6jci:A	704	55	0.1313	0.0185	0.2364	6.6

[Back]