TIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGSKNGIMDYKLGFVTEVIYVPLLKQRTAEELQELQKKLPDYLFETLS
FPLRSLNQFYIKMSKSLNK
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6mjc:A | 106 | 104 | 1.0000 | 0.9340 | 0.9519 | 1.70e-68 | 6mj8:B, 6mj8:A |
2 | 6dei:A | 107 | 105 | 0.7374 | 0.6822 | 0.6952 | 1.33e-48 | 6dei:B, 5v1a:A |
3 | 3ho8:D | 934 | 82 | 0.2525 | 0.0268 | 0.3049 | 3.5 | |
4 | 3bg5:A | 1137 | 82 | 0.2525 | 0.0220 | 0.3049 | 3.8 | 3bg5:C, 8gk8:A, 8gk8:B, 3hb9:A, 3hb9:C, 3hbl:A, 3hbl:C, 4hnt:A, 4hnt:C, 4hnu:A, 4hnu:C, 4hnv:A, 4hnv:C |
5 | 4hnv:B | 1033 | 82 | 0.2525 | 0.0242 | 0.3049 | 3.9 | 8gk8:D |
6 | 3bg5:B | 1074 | 82 | 0.2525 | 0.0233 | 0.3049 | 4.0 | 3bg5:D, 8gk8:C, 3hb9:B, 3hb9:D, 3hbl:B, 3hbl:D, 4hnt:B, 4hnt:D, 4hnu:B, 4hnu:D, 4hnv:D, 3ho8:A, 3ho8:C, 3ho8:B |
7 | 2ebf:X | 711 | 36 | 0.1515 | 0.0211 | 0.4167 | 4.8 | 2ebh:X |
8 | 7rd1:J | 942 | 67 | 0.2121 | 0.0223 | 0.3134 | 8.5 | 7rd1:L, 7rd1:A, 7rd1:C, 7rd1:D, 7rd1:F, 7rd1:B, 7rd1:E, 7rd1:G, 7rd1:H, 7rd1:K, 7rd1:I |
9 | 3ubm:B | 430 | 23 | 0.1212 | 0.0279 | 0.5217 | 9.6 | 3ubm:A, 3ubm:C, 3ubm:D |