BioLiP

>protein
TGSVDVLFPEYDDPPSEPITLLKRWLATADVARVREPKALALATATSDGRISSRVIAFSSIDDRGVIFCTHSTSRKGREL
TETGWASGLLYWRETGQQIMISGQAVPLEESENDKLWFGRSVPMHAMSSASHQSDELVDREALRAHAAELLALGVALPRP
PRFVGYRLEPHEMEFWAASSDRLHRRLRYERDGNDWKTTQLQP

The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4hmw:B	205	203	1.0000	0.9902	1.0000	2.74e-150	4hmw:A, 4hmx:A, 4hmx:B
2	4hmt:B	207	203	0.4828	0.4734	0.4828	7.57e-65	4hms:A, 4hms:B, 4hmt:A, 4hmu:A, 4hmu:B, 4hmv:A, 4hmv:B, 1ty9:A, 1ty9:B
3	1t9m:A	204	203	0.4631	0.4608	0.4631	3.60e-62	1t9m:B
4	1nrg:A	213	178	0.2906	0.2770	0.3315	1.06e-26	6h00:A, 3hy8:A, 8qyt:A, 8qyw:A
5	1jnw:A	214	194	0.2906	0.2757	0.3041	3.49e-26	1dnl:A, 1g76:A, 1g77:A, 1g78:A, 1g79:A, 6ylz:AAA, 6ymh:BBB
6	1ci0:A	205	195	0.2759	0.2732	0.2872	1.28e-19	1ci0:B
7	1wv4:A	162	191	0.2414	0.3025	0.2565	2.59e-19	1wv4:B, 6ymh:AAA
8	3jb9:L	293	44	0.0837	0.0580	0.3864	2.1
9	4ii3:A	986	26	0.0591	0.0122	0.4615	2.2	9b5c:A, 9b5d:A, 9b5e:A, 9b5f:A, 9b5g:A, 9b5h:A, 9b5i:A, 9b5j:A, 9b5k:A, 9b5l:A, 9b5m:A, 9b5n:A, 9b5o:A, 9b5p:A, 9b5q:A, 9b5r:A, 9b5s:A, 9b5t:A, 9b5u:A, 9b5v:A, 9b5w:A, 9b5x:A, 4ii2:A, 4ii3:C, 6o82:A, 6o82:C, 6o83:A, 6o83:C, 5um6:A
10	1ece:A	358	49	0.0837	0.0475	0.3469	3.5	1ece:B

[Back]