TGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCN
EPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTL
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3si5:A | 152 | 152 | 1.0000 | 1.0000 | 1.0000 | 9.75e-113 | 3si5:B |
2 | 4a1g:B | 149 | 142 | 0.3618 | 0.3691 | 0.3873 | 1.35e-32 | 4a1g:A, 4a1g:C, 4a1g:D |
3 | 8v87:8 | 477 | 117 | 0.1842 | 0.0587 | 0.2393 | 0.038 | 7nac:8, 7nad:8, 7naf:8, 7r6k:8, 7r72:8, 7r7a:8 |
4 | 8e5t:6 | 514 | 50 | 0.1053 | 0.0311 | 0.3200 | 1.3 | |
5 | 5jxt:M | 324 | 36 | 0.0789 | 0.0370 | 0.3333 | 1.6 | 5jxt:N, 5jxt:O, 5jxt:J, 5jxt:K, 5jxt:I, 5jxt:H |
6 | 6c8v:A | 312 | 74 | 0.1382 | 0.0673 | 0.2838 | 1.8 | |
7 | 6yxy:BE | 407 | 31 | 0.0658 | 0.0246 | 0.3226 | 2.7 | 7aoi:BE, 6hiv:BE, 6hix:BE, 6yxx:BE |
8 | 7exk:A | 217 | 59 | 0.1053 | 0.0737 | 0.2712 | 2.8 | 7exk:B, 7exk:C, 7exk:D, 7exk:E, 7exk:F |
9 | 4i9e:A | 383 | 37 | 0.0855 | 0.0339 | 0.3514 | 5.9 | 4i9c:A, 4i9e:B, 3ulq:A |
10 | 5aja:B | 84 | 37 | 0.0855 | 0.1548 | 0.3514 | 7.2 | 4z8l:B, 4z8l:E |
11 | 7x21:B | 277 | 50 | 0.0987 | 0.0542 | 0.3000 | 8.6 | 8ijl:B, 8ijm:B, 7x22:B, 7x24:B |