TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQ
PEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPP
GAE
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ubk:A | 709 | 162 | 0.9939 | 0.2285 | 1.0000 | 1.75e-110 | 4k2f:B, 4k2g:B, 3l91:B, 4m1j:C, 3srb:A, 3srb:B, 3src:B, 4wks:C, 4wkt:C, 4wku:B, 4wkv:C, 2wyc:A, 2wyc:B |
2 | 4yf9:D | 168 | 165 | 0.3620 | 0.3512 | 0.3576 | 4.12e-30 | 4yf9:A, 4yf9:G, 4yf9:J, 4yfa:A, 4yfa:D, 4yfa:G, 4yfa:J, 4yfb:D, 4yfb:A |
3 | 1jvz:A | 152 | 140 | 0.2331 | 0.2500 | 0.2714 | 5.79e-09 | |
4 | 1gm9:A | 207 | 110 | 0.2025 | 0.1594 | 0.3000 | 1.43e-05 | 1fxh:A, 1fxv:A, 1k7d:A, 1kec:A |
5 | 7rep:A | 764 | 112 | 0.1718 | 0.0366 | 0.2500 | 3.99e-04 | 4pel:B, 4pel:D, 4pel:F, 4pel:H, 4pem:B, 7reo:A |
6 | 1nr9:A | 211 | 50 | 0.1104 | 0.0853 | 0.3600 | 0.13 | 1nr9:B, 1nr9:C, 1nr9:D |
7 | 6nvy:A | 191 | 25 | 0.0736 | 0.0628 | 0.4800 | 0.47 | 6nvy:C |
8 | 6nje:A | 297 | 56 | 0.1411 | 0.0774 | 0.4107 | 0.70 | |
9 | 3oqq:A | 411 | 51 | 0.0982 | 0.0389 | 0.3137 | 3.8 | |
10 | 4bxc:A | 929 | 122 | 0.1779 | 0.0312 | 0.2377 | 5.2 | 4bxc:B, 3zgb:A, 3zgb:B, 3zge:A, 3zge:B |
11 | 7xw2:A | 725 | 58 | 0.0920 | 0.0207 | 0.2586 | 5.3 | |
12 | 6laa:A | 753 | 73 | 0.1411 | 0.0305 | 0.3151 | 6.1 | 6gii:A, 6ldl:A |