TFSGVVDIIVVRQPDDSLKSMPFHIRFNQNINIQITVNDKKIEDVFMLMLPEGACYFPEQKKLRPSSAILKKFNLKNGYN
KIQFIAESDLQGKQLIEGKIYLYNYDTKLVISDVDGTVTKSEWTHDDIAELYTNIQKNGYKMVYLSSRPLYFYNYTQGYL
KGIIQNGFTMPDGPILLSPDQEFKGALLKDLRRVFPEEVNPIFAGFGNRDTDATACLYAGVIIDNIFIINEQSQVEILGK
QEKSSYKKINEKIQELFPRLP
The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tzz:A | 277 | 278 | 0.9923 | 0.9350 | 0.9317 | 0.0 | 6tzy:A, 6tzy:B, 6tzy:C, 6tzy:D, 6tzz:B |
2 | 8pj9:A | 1051 | 68 | 0.0728 | 0.0181 | 0.2794 | 0.14 | |
3 | 2zue:A | 628 | 41 | 0.0651 | 0.0271 | 0.4146 | 0.24 | 2zuf:A |
4 | 4dwo:A | 268 | 45 | 0.0651 | 0.0634 | 0.3778 | 0.40 | 3niw:A |
5 | 6qw6:63 | 85 | 43 | 0.0421 | 0.1294 | 0.2558 | 1.1 | 6ah0:r, 6qx9:63, 8qxd:63, 8r08:63, 8r09:63, 8r0a:63, 8r0b:63, 8rm5:63 |
6 | 6ijb:B | 538 | 47 | 0.0536 | 0.0260 | 0.2979 | 1.7 | 6ihk:B |
7 | 3s6t:A | 575 | 51 | 0.0651 | 0.0296 | 0.3333 | 4.9 | 3nsn:A, 3ozo:A, 3ozp:A, 3vtr:A, 3wmb:A, 3wmc:A, 5y0v:A, 5y1b:A |
8 | 8i54:A | 1113 | 50 | 0.0575 | 0.0135 | 0.3000 | 7.8 | |
9 | 2rg4:A | 206 | 55 | 0.0536 | 0.0680 | 0.2545 | 8.4 | 2rg4:B |
10 | 8h9d:A | 1114 | 21 | 0.0345 | 0.0081 | 0.4286 | 8.7 |