TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSK
QQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLR
RELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1t5e:C | 231 | 231 | 1.0000 | 1.0000 | 1.0000 | 3.86e-169 | 1t5e:E, 1t5e:F, 1t5e:G, 1t5e:H, 1t5e:I, 1t5e:K, 1t5e:L |
2 | 2k33:A | 116 | 134 | 0.1818 | 0.3621 | 0.3134 | 2.56e-10 | |
3 | 3lnn:A | 341 | 244 | 0.2944 | 0.1994 | 0.2787 | 1.06e-09 | |
4 | 5c22:B | 267 | 59 | 0.0823 | 0.0712 | 0.3220 | 0.014 | |
5 | 3hrd:A | 420 | 72 | 0.0779 | 0.0429 | 0.2500 | 0.37 | 3hrd:E |
6 | 8pn8:G | 213 | 88 | 0.0952 | 0.1033 | 0.2500 | 0.41 | 8pn7:G, 8pn7:H, 8pn7:I, 8pn7:J, 8pn7:K, 8pn7:L, 8pn8:H, 8pn8:I, 8pn8:J, 8pn8:K, 8pn8:L, 6ybq:G, 6ybq:H, 6ybq:I, 6ybq:J, 6ybq:K, 6ybq:L |
7 | 1iru:A | 244 | 51 | 0.0736 | 0.0697 | 0.3333 | 0.64 | 1iru:O |
8 | 5u84:B | 353 | 54 | 0.0649 | 0.0425 | 0.2778 | 1.7 | 5u84:A |
9 | 8cub:C | 588 | 66 | 0.0952 | 0.0374 | 0.3333 | 3.4 | 8cub:A, 7r8a:A, 7r8b:A |
10 | 3txa:A | 583 | 31 | 0.0563 | 0.0223 | 0.4194 | 4.7 | 3tvy:A, 3tw0:A, 3tw0:B, 3tw0:C, 3tw0:D |
11 | 8odq:D | 410 | 65 | 0.0779 | 0.0439 | 0.2769 | 7.0 | 8odq:B |
12 | 6fop:A | 717 | 38 | 0.0649 | 0.0209 | 0.3947 | 7.8 | |
13 | 6khm:K | 312 | 63 | 0.0909 | 0.0673 | 0.3333 | 8.0 | 6khl:A, 6khl:B, 6khm:A, 6khm:B, 6khm:C, 6khm:D, 6khm:E, 6khm:F, 6khm:G, 6khm:H, 6khm:I, 6khm:J, 6khm:L, 6khm:M, 6khm:N, 6khm:O, 6khm:P, 6khm:Q, 6khm:R, 6khm:S, 6khm:T, 6khm:U, 6khm:V, 6khm:X, 6khm:Y, 6khm:W, 6khm:Z |
14 | 8rth:A | 666 | 25 | 0.0519 | 0.0180 | 0.4800 | 8.5 | 8rth:C, 8rth:E, 8rth:G, 8rth:I, 8rth:K |
15 | 4koa:A | 333 | 67 | 0.0909 | 0.0631 | 0.3134 | 9.6 | |
16 | 2np0:A | 1289 | 45 | 0.0693 | 0.0124 | 0.3556 | 9.8 | 1epw:A, 2etf:A, 2etf:B, 1f31:A, 1f82:A, 6g5f:B, 6g5g:B, 6g5k:A, 6g5k:B, 1g9a:A, 1g9b:A, 1g9c:A, 1g9d:A, 1i1e:A, 4kbb:A, 4kbb:B, 7na9:A, 2nm1:A, 6qns:A, 1s0b:A, 1s0c:A, 1s0d:A, 1s0e:A, 1s0f:A, 7t5f:A, 7t5f:D, 2xhl:A, 3zuq:A, 6zvm:AAA |
17 | 6ogz:A | 1082 | 85 | 0.1082 | 0.0231 | 0.2941 | 9.9 | 6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B |
18 | 6g21:A | 504 | 34 | 0.0563 | 0.0258 | 0.3824 | 9.9 | 6g21:B |