BioLiP

>protein
TDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVS
ELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMDKCK
QDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGAD
AQEDLRWFRSTSGPGMPMNWPQFEEW

The query sequence (length=266) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3q84:G	287	285	1.0000	0.9268	0.9333	0.0	3hah:A, 3hah:B, 3q84:B, 3q84:N, 3qni:A, 3qni:B
2	3q0k:D	289	289	0.7481	0.6886	0.6886	2.01e-144	3aco:A, 3haj:A, 3haj:B, 3lll:A, 3lll:B, 3q0k:A, 3q0k:B, 3q0k:C
3	3qe6:B	286	283	0.5602	0.5210	0.5265	5.41e-117	3qe6:A
4	7aam:B	287	291	0.2143	0.1986	0.1959	2.84e-04	7aam:A
5	2q9c:A	304	87	0.0977	0.0855	0.2989	3.0	2cnw:D, 2cnw:E, 2cnw:F, 2iyl:D, 2j7p:D, 2j7p:E, 2q9b:A, 2xkv:D
6	3bga:A	1003	75	0.0752	0.0199	0.2667	3.9	3bga:B
7	7xin:A	470	108	0.0789	0.0447	0.1944	4.7	7xin:C, 7xin:E
8	7ok0:B	1109	38	0.0414	0.0099	0.2895	4.8	7oq4:B, 7oqy:B
9	8opt:A	783	47	0.0489	0.0166	0.2766	6.3	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
10	1tqh:A	242	41	0.0489	0.0537	0.3171	7.9
11	5vdk:A	260	33	0.0526	0.0538	0.4242	8.3
12	7zjs:A	929	45	0.0564	0.0161	0.3333	9.2	8k4d:A, 6qnx:A, 7zjs:C
13	6ujf:A	301	58	0.0752	0.0664	0.3448	9.7

[Back]