TDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGI
QETSSGYPRIHAPELQEWGGTMAALVDPDGTLLRLIQNE
The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1niq:B | 125 | 119 | 1.0000 | 0.9520 | 1.0000 | 5.97e-87 | 1ewj:A, 1ewj:B, 1ewj:C, 1ewj:D, 1ewj:E, 1ewj:F, 1ewj:G, 1ewj:H, 1niq:C |
2 | 6p29:A | 134 | 131 | 0.2605 | 0.2313 | 0.2366 | 0.001 | 6p29:B |
3 | 3h2b:B | 196 | 51 | 0.1429 | 0.0867 | 0.3333 | 0.98 | 3h2b:A |
4 | 6t0f:A | 431 | 36 | 0.1345 | 0.0371 | 0.4444 | 4.3 | 6t0f:B, 6t0f:C, 6t0f:D, 6t0g:A, 6t0h:A, 6t0j:A, 6t0k:A, 6t0l:A, 2wm4:A, 2wm5:A, 7zb9:A |
5 | 5k2m:G | 273 | 99 | 0.2017 | 0.0879 | 0.2424 | 5.0 | 5k2m:I, 5k2m:A, 5k2m:B, 5k2m:C, 5k2m:D, 5k2m:H, 5k2m:J |
6 | 6enk:A | 298 | 27 | 0.0924 | 0.0369 | 0.4074 | 8.1 | |
7 | 7oop:M | 810 | 30 | 0.1008 | 0.0148 | 0.4000 | 8.4 | 7opc:M, 7opd:M |