Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
TDITIYYKTGWTHPHIHYSLNQGAWTTLPGVPLTKSEYEGYVKVTIEAEEGSQLRAAFNNGSGQWDNNQGRDYDFSSGVH
TLADGRILSGTPK

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2c3w:B 95 93 1.0000 0.9789 1.0000 1.40e-66 2c3w:A, 2c3w:C, 2c3w:D, 2c3x:A
2 4tlm:C 750 21 0.1183 0.0147 0.5238 0.37 4tll:C
3 3zx1:A 471 75 0.2043 0.0403 0.2533 0.49
4 2z1a:A 507 22 0.1075 0.0197 0.4545 0.62
5 5eqc:A 426 25 0.1183 0.0258 0.4400 2.3 5dj9:A, 5dj9:B, 5e3k:A, 5e3k:B, 5e5i:A, 5e5i:B, 5eqc:B, 4nog:A, 4nog:B, 4zlv:A, 4zlv:B, 4zwm:A, 4zwm:B
6 6je8:A 469 35 0.1505 0.0299 0.4000 2.6 6jea:A, 6jeb:A
7 6rxt:UQ 789 60 0.2151 0.0253 0.3333 3.1 6rxu:UQ, 6rxv:UQ, 6rxx:UQ, 6rxy:UQ, 6rxz:UQ
8 3dha:A 254 51 0.1828 0.0669 0.3333 3.8 2a7m:A, 2br6:A, 2btn:A, 3dhb:A, 3dhc:A, 5eh9:A, 5eht:A, 4j5f:A, 4j5h:A, 7l5f:A
9 2xl7:A 235 27 0.1290 0.0511 0.4444 6.4 2xl9:A, 2xl9:B, 2xla:A, 2xla:B, 2xla:C, 2xla:D, 2xlg:A
10 7vmx:B 359 66 0.2258 0.0585 0.3182 8.0

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417