BioLiP

>protein
TDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLI
VDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERK

The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5njk:A	147	143	1.0000	0.9728	1.0000	2.36e-103	5njj:A, 5njj:C, 5njj:B, 5njj:D, 5njk:E, 5njk:C, 5njk:D, 5njk:B, 5njk:F
2	2nmb:A	147	143	0.6713	0.6531	0.6713	4.59e-64	1ddm:A, 5yi7:A, 5yi7:C, 5yi8:A
3	6itu:A	146	125	0.2727	0.2671	0.3120	4.21e-18
4	3so6:A	137	130	0.2867	0.2993	0.3154	1.01e-15
5	1ntv:A	152	120	0.2727	0.2566	0.3250	6.82e-09	1nu2:A, 1oqn:A, 1oqn:B
6	6ovf:A	154	117	0.2238	0.2078	0.2735	4.82e-07	1m7e:A, 1m7e:B, 1m7e:C, 6o5o:A, 6o5o:B, 6ovf:B
7	2qxf:A	433	75	0.1538	0.0508	0.2933	0.047
8	4js4:A	468	75	0.1538	0.0470	0.2933	0.048	3c94:A, 4hcb:A, 4hcb:B, 4hcc:A, 4hcc:B, 3hl8:A, 3hp9:A, 4jrp:A, 4jrp:B, 4jrq:A, 4jrq:B, 4js4:B, 4js5:A, 4js5:B
9	3d8f:A	127	60	0.1119	0.1260	0.2667	0.24	3d8f:C
10	8wm6:B	732	39	0.0909	0.0178	0.3333	2.0	8wmj:B, 8wmv:B, 8wmw:B
11	5koh:A	483	115	0.2168	0.0642	0.2696	3.9	5koh:C, 5koj:A, 5koj:C
12	6kr2:A	857	47	0.1049	0.0175	0.3191	4.8	6izx:A, 6izy:A, 6kr2:B, 6kr3:A
13	7ane:am	272	47	0.0839	0.0441	0.2553	8.6

[Back]