TATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSES
LTYCISRRAQGVTLQDLPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVM
DDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQT
RYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAG
The query sequence (length=296) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3w0s:A | 298 | 296 | 1.0000 | 0.9933 | 1.0000 | 0.0 | 3tyk:A, 3w0n:A, 3w0o:A, 3w0p:A, 3w0q:A, 3w0r:A |
| 2 | 5igi:A | 300 | 84 | 0.0878 | 0.0867 | 0.3095 | 0.012 | 5igj:A, 5igp:A, 5igr:A, 5igs:A, 5igt:A |
| 3 | 7f0b:A | 282 | 43 | 0.0574 | 0.0603 | 0.3953 | 0.014 | 7f0c:A, 7f0f:A |
| 4 | 3ham:A | 299 | 217 | 0.1520 | 0.1505 | 0.2074 | 0.015 | 4dca:A, 3ham:B, 3hav:A, 3hav:B, 3hav:C, 3uzr:A |
| 5 | 8i85:A | 280 | 43 | 0.0608 | 0.0643 | 0.4186 | 0.035 | 8i82:A, 8i84:A, 8i86:A, 8i89:A, 8i8g:A, 8i8h:A |
| 6 | 5uxd:A | 300 | 36 | 0.0439 | 0.0433 | 0.3611 | 0.33 | 5uxc:A, 5uxd:B |
| 7 | 7khj:A | 288 | 70 | 0.0676 | 0.0694 | 0.2857 | 0.58 | 7khj:B, 7khk:B, 1pkg:B, 8pqb:A, 8pqe:A, 8pqe:B |
| 8 | 2b0q:A | 263 | 166 | 0.1216 | 0.1369 | 0.2169 | 0.65 | 2bkk:A, 2bkk:C, 1j7l:A, 1j7l:B, 1j7u:A, 1j7u:B, 1l8t:A, 3q2j:A, 3q2j:B, 3tm0:A |
| 9 | 3g0e:A | 332 | 40 | 0.0473 | 0.0422 | 0.3500 | 1.1 | 3g0f:A, 3g0f:B, 6gqj:A, 6gqj:B, 6gqk:A, 6gqk:B, 6gql:A, 6gql:B, 6gqm:A, 6gqm:B, 6hh1:A, 4hvs:A, 6itt:A, 6itt:B, 6itv:A, 7khg:A, 7khk:A, 6kla:A, 6mob:A, 1pkg:A, 8pq9:A, 8pq9:C, 8pqa:A, 8pqa:C, 8pqc:A, 8pqc:B, 8pqd:A, 8pqd:B, 8pqf:A, 8pqf:C, 8pqg:A, 8pqg:C, 1t46:A, 4u0i:A, 6xv9:A, 6xv9:B, 6xva:A, 6xva:B, 6xvb:A, 6xvb:B, 7zw8:A, 7zy6:A |
| 10 | 6a5n:A | 502 | 53 | 0.0608 | 0.0359 | 0.3396 | 1.1 | |
| 11 | 5uxa:A | 301 | 85 | 0.0676 | 0.0664 | 0.2353 | 1.3 | 5igv:A, 5igw:A, 5igy:A, 5igz:A, 5ih0:A, 5ih1:A, 5iwu:A |
| 12 | 1y9g:A | 517 | 63 | 0.0709 | 0.0406 | 0.3333 | 1.7 | |
| 13 | 6il3:A | 310 | 42 | 0.0473 | 0.0452 | 0.3333 | 1.8 | 6jqr:A, 4rt7:A, 5x02:A, 4xuf:A, 4xuf:B |
| 14 | 7w15:A | 294 | 54 | 0.0608 | 0.0612 | 0.3333 | 2.1 | 7w15:B, 7w19:A, 7w19:B, 7w1a:B, 7w1a:A |
| 15 | 6iy9:A | 325 | 66 | 0.0541 | 0.0492 | 0.2424 | 3.6 | 6iy9:B |
| 16 | 4e1z:A | 288 | 87 | 0.0743 | 0.0764 | 0.2529 | 3.7 | 4e20:A |
| 17 | 3f69:B | 283 | 94 | 0.0878 | 0.0919 | 0.2766 | 3.7 | 6b2p:A, 3f61:A, 3f69:A, 2fum:A, 2fum:B, 2fum:C, 2fum:D, 6i2p:A, 6i2p:B, 1mru:A, 1mru:B, 1o6y:A, 3ori:A, 3ori:B, 3ori:C, 3ori:D, 3ork:A, 3orl:A, 3orm:A, 3oro:A, 3orp:A, 3ort:A, 5u94:A |
| 18 | 7ezt:B | 727 | 23 | 0.0439 | 0.0179 | 0.5652 | 3.8 | |
| 19 | 3i0o:A | 329 | 30 | 0.0405 | 0.0365 | 0.4000 | 3.8 | 3i0q:A, 3q2m:A |
| 20 | 8dqw:E | 354 | 91 | 0.0743 | 0.0621 | 0.2418 | 5.8 | 8dqx:E, 8dqz:E, 8dr0:E, 8dr1:E, 8dr3:E, 8dr4:E, 8dr5:E, 8dr6:E, 8dr7:E, 8fs3:E, 8fs4:E, 8fs5:E, 8fs6:E, 8fs7:E, 7sgz:E, 7sh2:E, 7st9:E, 7stb:E, 7ste:E, 7tfh:E, 7tfi:E, 7tfj:E, 7tfk:E, 7tfl:E, 7thj:E, 7thv:E, 8thb:E, 8thc:E, 8thd:E, 7ti8:E, 7tib:E, 7tic:E, 7tid:E, 7tku:E, 8tw7:5, 8tw8:5, 8twa:5, 8twb:5, 7u19:E, 7u1a:E, 7u1p:E |
| 21 | 8bx8:C | 3947 | 76 | 0.0608 | 0.0046 | 0.2368 | 5.8 | 7k58:C, 7k5b:C, 7kek:C |
| 22 | 7k5b:B | 4524 | 76 | 0.0676 | 0.0044 | 0.2632 | 7.4 | 8bx8:B, 7k58:B, 7kek:B |
| 23 | 1r5a:A | 214 | 71 | 0.0642 | 0.0888 | 0.2676 | 7.4 | |
| 24 | 7s3l:A | 254 | 52 | 0.0473 | 0.0551 | 0.2692 | 7.9 | |
| 25 | 6joj:A | 338 | 52 | 0.0541 | 0.0473 | 0.3077 | 9.5 | 5grn:A, 6jok:A, 6jol:A, 8pqh:A |
umich.edu