TASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGA
LNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYA
The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7acs:A | 140 | 125 | 1.0000 | 0.8214 | 0.9200 | 9.45e-80 | 7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D |
2 | 6wkp:A | 103 | 114 | 0.8957 | 1.0000 | 0.9035 | 1.08e-68 | |
3 | 6lz8:B | 130 | 123 | 0.6000 | 0.5308 | 0.5610 | 5.07e-42 | 6kl5:A, 6kl6:B |
4 | 6lz8:D | 112 | 114 | 0.5826 | 0.5982 | 0.5877 | 1.85e-41 | 7dyd:D, 6kl5:C, 6kl6:D, 6lnn:D, 6lz6:D |
5 | 4kxj:A | 135 | 124 | 0.4783 | 0.4074 | 0.4435 | 3.24e-26 | 4li4:A, 4lm7:A, 4lm9:A, 4lmc:A, 4lmt:A |
6 | 3lya:A | 318 | 34 | 0.1217 | 0.0440 | 0.4118 | 2.0 | |
7 | 6omp:A | 356 | 72 | 0.2000 | 0.0646 | 0.3194 | 4.8 | 6omp:B, 6omq:A, 6omq:B, 6omr:A, 6omr:B |
8 | 6v8o:O | 384 | 94 | 0.2174 | 0.0651 | 0.2660 | 5.9 | 6v92:O |