SYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDE
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8osb:B | 66 | 66 | 1.0000 | 1.0000 | 1.0000 | 6.02e-43 | |
2 | 2ypa:A | 67 | 61 | 0.4848 | 0.4776 | 0.5246 | 1.44e-15 | 2ypb:A |
3 | 2ql2:B | 59 | 59 | 0.4242 | 0.4746 | 0.4746 | 7.22e-12 | 2ql2:D |
4 | 7z5i:A | 56 | 51 | 0.3030 | 0.3571 | 0.3922 | 2.71e-07 | 7z5i:B, 7z5k:A, 7z5k:B |
5 | 1mdy:A | 68 | 56 | 0.3182 | 0.3088 | 0.3750 | 4.38e-07 | 1mdy:B, 1mdy:C, 1mdy:D |
6 | 1hlo:A | 80 | 51 | 0.2576 | 0.2125 | 0.3333 | 7.62e-06 | |
7 | 5eyo:C | 88 | 55 | 0.2576 | 0.1932 | 0.3091 | 1.18e-05 | 1an2:A, 5eyo:A, 1hlo:B, 1nkp:B, 1nkp:E, 1nlw:B, 1nlw:E |
8 | 5i50:B | 96 | 53 | 0.3485 | 0.2396 | 0.4340 | 0.002 | 5i50:A, 1nkp:A, 1nkp:D |
9 | 5gnj:B | 77 | 43 | 0.2727 | 0.2338 | 0.4186 | 0.006 | 5gnj:G, 5gnj:I, 5gnj:A, 5gnj:E, 5gnj:F, 5gnj:M, 5gnj:N |
10 | 6od3:A | 62 | 37 | 0.2273 | 0.2419 | 0.4054 | 0.100 | 6od3:B, 6od3:H, 6od3:E, 6od3:F, 6od4:A, 6od4:B, 6od5:A, 6od5:B, 6od5:C, 6od5:D, 8osb:A |
11 | 2ypb:B | 74 | 55 | 0.3182 | 0.2838 | 0.3818 | 0.26 | 2ql2:A, 2ql2:C, 2ypa:B |
12 | 8ia3:E | 111 | 59 | 0.3182 | 0.1892 | 0.3559 | 0.42 | 8ia3:A, 8ia3:B, 8ia3:F |
13 | 8ow1:B | 116 | 50 | 0.2424 | 0.1379 | 0.3200 | 2.1 | 8ovw:A, 8ovw:B, 8ow0:A, 8ow0:B, 8ow1:A, 7ssa:L, 7ssa:K |
14 | 1an4:A | 65 | 59 | 0.3182 | 0.3231 | 0.3559 | 2.1 | 1an4:B |
15 | 2qgi:A | 248 | 41 | 0.2121 | 0.0565 | 0.3415 | 2.5 | 2qgi:B |
16 | 5l6v:I | 400 | 32 | 0.1212 | 0.0200 | 0.2500 | 3.6 | |
17 | 6r8u:A | 425 | 32 | 0.1212 | 0.0188 | 0.2500 | 3.6 | 5l6s:C, 5l6s:G, 5l6s:I, 5l6s:L, 5l6v:A, 5l6v:E, 5l6v:G, 5l6v:H, 5l6v:J, 5l6v:K, 5l6v:N, 5l6v:B, 5l6v:C, 5l6v:D, 5l6v:F, 5l6v:L, 5l6v:M, 5l6v:O, 5l6v:P, 6r8b:D, 6r8b:B, 6r8b:A, 6r8b:C, 6r8u:B, 6r8u:D, 6r8u:C, 6shj:D, 6shj:A, 6shj:B, 6shj:C, 6shn:D, 6shn:C, 6shq:A, 6shq:D, 6shq:C, 6shq:B, 6si8:A, 6si8:B, 6si8:D, 6si8:C |
18 | 6n1x:A | 377 | 26 | 0.1364 | 0.0239 | 0.3462 | 9.6 | 6d9t:A |
19 | 2y7d:D | 278 | 23 | 0.1212 | 0.0288 | 0.3478 | 9.7 | 2y7d:A, 2y7d:B, 2y7d:C, 2y7e:A, 2y7e:B, 2y7f:A, 2y7f:B, 2y7f:C, 2y7f:D, 2y7g:A, 2y7g:B |