SVYFDLEDLGNTTGQWDSYGSDAPSPYNPLQSKLFETFAAPFTKRGLLLKFLILGGGSTLAYLSATASGDILPITRGPQQ
PPKLGPRGKI
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4xk8:H | 90 | 90 | 1.0000 | 1.0000 | 1.0000 | 8.58e-61 | 4xk8:h |
2 | 7wfd:AH | 95 | 90 | 0.8667 | 0.8211 | 0.8667 | 3.72e-54 | 8j6z:H, 8j7a:H, 8j7b:H, 2o01:H, 7wfe:BH, 7wg5:AH, 2wsc:H, 2wse:H, 2wsf:H |
3 | 6yez:H | 93 | 87 | 0.8778 | 0.8495 | 0.9080 | 2.45e-52 | 7dkz:H, 5l8r:H, 3lw5:H, 4rku:H, 4y28:H, 6yac:H, 6zoo:H, 6zxs:H |
4 | 8htu:H | 95 | 89 | 0.6222 | 0.5895 | 0.6292 | 1.71e-38 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
5 | 8wgh:H | 90 | 90 | 0.8000 | 0.8000 | 0.8000 | 3.63e-32 | |
6 | 5zji:H | 95 | 90 | 0.8333 | 0.7895 | 0.8333 | 4.89e-32 | 8bcv:H, 8bcw:H |
7 | 6zzx:H | 94 | 90 | 0.4667 | 0.4468 | 0.4667 | 4.92e-22 | 6zzy:H |
8 | 7yca:H | 96 | 91 | 0.4556 | 0.4271 | 0.4505 | 1.08e-14 | |
9 | 6igz:H | 88 | 87 | 0.4222 | 0.4318 | 0.4368 | 5.41e-13 | |
10 | 7d0j:H | 100 | 91 | 0.3667 | 0.3300 | 0.3626 | 1.02e-12 | 7dz7:H, 7dz8:H, 8h2u:H, 6ijo:H |
11 | 6sl5:H | 92 | 90 | 0.3778 | 0.3696 | 0.3778 | 1.43e-11 | |
12 | 5why:A | 418 | 45 | 0.1778 | 0.0383 | 0.3556 | 0.66 | |
13 | 5t04:A | 458 | 19 | 0.1000 | 0.0197 | 0.4737 | 4.5 | 4grv:A |
14 | 2wya:A | 460 | 31 | 0.1444 | 0.0283 | 0.4194 | 5.6 | 2wya:B, 2wya:C, 2wya:D |
15 | 5v1d:A | 193 | 88 | 0.2778 | 0.1295 | 0.2841 | 6.3 | |
16 | 5i4e:A | 959 | 21 | 0.1222 | 0.0115 | 0.5238 | 8.2 |