BioLiP

>protein
SVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIAEIKKASPSKGVLREHFVPAEI
ARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPVIRKDFMIDPYQIVEARAIGADCILLIVSALDDVLMAELAAT
AKSVGLDVLVEVHDGTELERALKTLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSEV
YAFLVGEAFMRADDPGLELKRLFFQ

The query sequence (length=265) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6y88:B	265	265	1.0000	1.0000	1.0000	0.0	6y88:A, 6y88:C, 6y88:D, 6y88:E, 6y88:F, 6y88:G, 6y88:H
2	3t44:A	259	254	0.3811	0.3900	0.3976	3.65e-45	3t40:A, 3t55:A, 3t78:A
3	1pii:A	452	262	0.4038	0.2367	0.4084	9.80e-44	1jcm:P
4	7etx:A	472	264	0.3849	0.2161	0.3864	1.22e-39	7ety:A, 7ety:B
5	1vc4:B	254	257	0.3887	0.4055	0.4008	8.67e-37
6	3uz5:A	247	207	0.2415	0.2591	0.3092	2.61e-21	3uz5:B, 3uzj:A, 3uzj:B
7	3nz1:A	249	207	0.2302	0.2450	0.2947	4.62e-21	4a29:A, 4a2s:A, 1a53:A, 8foq:A, 1igs:A, 4iww:A, 4iww:B, 1juk:A, 5k7j:A, 5k7j:B, 1lbf:A, 1lbl:A, 6nw4:A, 4ou1:A, 3ud6:A, 3uxd:A, 3uxd:B
8	4a2r:A	247	207	0.2340	0.2510	0.2995	5.15e-21	5an7:A, 4pa8:A, 8xyn:A, 8xyn:B
9	7pao:9	682	56	0.0755	0.0293	0.3571	1.5	7paq:9, 7par:9, 7pib:9, 7pis:9, 7pit:9
10	1xco:D	325	77	0.0679	0.0554	0.2338	3.9	1xco:A, 1xco:B, 1xco:C, 1xco:E, 1xco:F
11	6vc6:B	440	69	0.0792	0.0477	0.3043	5.8	6vc6:A, 6vc6:C, 6vc6:D
12	6k13:A	332	119	0.1208	0.0964	0.2689	6.3	6k13:B
13	8ajp:A	199	52	0.0642	0.0854	0.3269	7.7

[Back]