BioLiP

>protein
SVPTKLEVVAATPTSLLVSWDAPAVTVVFYDITYGETGGNSPVQEFTVPGSKSTATISGLSPGVDYTITVYAKYLFWSGY
SSPISINYRTE

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8f0m:B	91	91	1.0000	1.0000	1.0000	2.08e-60
2	5v7p:D	95	92	0.8462	0.8105	0.8370	4.92e-45
3	5a43:C	96	93	0.8681	0.8229	0.8495	5.79e-44
4	4lxo:A	184	91	0.8022	0.3967	0.8022	8.93e-43	4lxo:B
5	6d0j:C	90	91	0.8132	0.8222	0.8132	1.01e-42	6d0k:C, 6d0n:C
6	6ux8:B	86	89	0.8022	0.8488	0.8202	1.26e-42
7	3ch8:A	190	90	0.8022	0.3842	0.8111	1.55e-41	2qbw:A
8	4jmh:A	200	90	0.7912	0.3600	0.8000	1.43e-40	4jmg:A
9	5mtm:B	92	91	0.7692	0.7609	0.7692	2.53e-39
10	8vxu:E	90	92	0.7912	0.8000	0.7826	6.20e-39	7szt:F, 8tgy:C, 8tgy:D, 6wk9:C, 6wk9:G
11	7l0f:H	94	98	0.8022	0.7766	0.7449	9.90e-39	7l0f:F, 7l0f:B, 7l0f:M, 7l0g:C, 7l0g:D, 7l0g:F, 7l0g:H
12	3csb:A	464	92	0.7802	0.1530	0.7717	3.17e-37
13	6x39:A	100	77	0.3077	0.2800	0.3636	2.27e-04
14	2mnu:A	93	88	0.3187	0.3118	0.3295	2.81e-04
15	6gvk:A	201	78	0.2967	0.1343	0.3462	5.25e-04	6gvl:A
16	6gvk:A	201	72	0.2308	0.1045	0.2917	0.088	6gvl:A
17	1eba:A	212	72	0.1868	0.0802	0.2361	0.52	1eba:B, 1ebp:A, 1ebp:B
18	2adc:A	208	19	0.1099	0.0481	0.5263	2.6
19	3poa:A	96	44	0.1319	0.1250	0.2727	3.4
20	3mdj:C	819	70	0.1868	0.0208	0.2429	4.0	3mdj:A
21	3hbg:A	353	47	0.1868	0.0482	0.3617	5.0
22	4xyj:A	768	25	0.1209	0.0143	0.4400	6.3	4rh3:A, 4rh3:B, 4rh3:C, 4rh3:D, 4u1r:A, 4u1r:B, 4u1r:C, 4u1r:D, 4wl0:A, 4wl0:B, 4wl0:C, 4wl0:D, 4xyj:B, 4xyj:C, 4xyj:D, 4xyj:E, 4xyj:F, 4xyj:G, 4xyj:H, 4xyk:A, 4xyk:B, 4xyk:C, 4xyk:D, 4xz2:A, 4xz2:B, 4xz2:C, 4xz2:D
23	2fgy:A	471	26	0.1209	0.0234	0.4231	9.9	2fgy:B

[Back]