BioLiP

>protein
SVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAK
PTRLNVFKNDQDTWDYTNP

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2mqp:A	118	99	1.0000	0.8390	1.0000	5.66e-71	7evr:A, 7evr:C
2	7evs:A	101	99	0.7273	0.7129	0.7273	1.14e-53	7evs:B
3	2adb:A	127	96	0.4242	0.3307	0.4375	1.29e-20	3zzy:A, 3zzy:B, 3zzz:A, 3zzz:B
4	2adc:A	208	100	0.3030	0.1442	0.3000	9.54e-05
5	6dg0:B	84	72	0.2121	0.2500	0.2917	0.004	6dg0:A
6	4qqb:A	169	70	0.2424	0.1420	0.3429	0.030	1b7f:A, 1b7f:B, 4qqb:B
7	7b9v:Y	88	61	0.1717	0.1932	0.2787	0.19	6bk8:r, 7dco:p, 6exn:Y, 6g90:Y, 5gmk:a, 6j6g:a, 6j6h:a, 6j6n:a, 6j6q:a, 5lj3:Y, 5lj5:Y, 5mq0:Y, 5nrl:Y, 7oqb:Y, 7oqe:Y, 5wsg:X, 5y88:p, 5ylz:p, 5zwm:p, 5zwo:p
8	6hip:A	104	45	0.1717	0.1635	0.3778	0.68	6hip:B, 5lso:A, 5lso:B, 2peh:A, 2peh:B
9	1rk8:A	87	23	0.1111	0.1264	0.4783	1.4
10	5det:B	94	37	0.1515	0.1596	0.4054	1.9	5det:A
11	3llx:A	373	38	0.1010	0.0268	0.2632	3.1
12	3lqv:B	115	69	0.1919	0.1652	0.2754	3.3	2f9j:B, 3lqv:A, 7q4o:F, 8qo9:B6, 8qxd:B6, 8qzs:B6, 8r08:B6, 8r09:B6, 8r0a:B6, 8r0b:B6, 8rm5:B6
13	2oo0:A	419	65	0.2121	0.0501	0.3231	3.6	5bwa:A, 7odc:A, 2on3:A, 2on3:B, 2oo0:B, 7s3f:A, 7s3f:B, 7s3g:A, 7s3g:B, 7u6p:A, 7u6p:B, 7u6u:A, 7u6u:B, 4zgy:A
14	2xb2:D	89	22	0.0909	0.1011	0.4091	5.9	2xb2:Z
15	2x1f:A	94	71	0.2020	0.2128	0.2817	6.0	2km8:B, 2x1a:A
16	1rjl:C	95	25	0.1111	0.1158	0.4400	7.8

[Back]