BioLiP

>protein
STTTYSSFRKNYYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKRPFDFDF
FAHLLQKVLAEEEKRKQK

The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ity:W	111	98	1.0000	0.8829	1.0000	9.90e-70	8iue:W, 8iuh:W, 5n9g:C, 5n9g:H
2	6f44:W	172	87	0.3367	0.1919	0.3793	2.18e-16	6f42:W
3	6cnb:S	217	87	0.3367	0.1521	0.3793	4.11e-16	6cnc:S, 6cnd:S, 6cnf:S
4	6f40:W	218	87	0.3367	0.1514	0.3793	4.35e-16	6f41:W
5	6eu0:V	273	87	0.3367	0.1209	0.3793	1.05e-15	7q5b:X
6	3osg:A	110	51	0.1633	0.1455	0.3137	0.006	3osf:A, 3osf:D, 3osg:D
7	3osg:A	110	37	0.1122	0.1000	0.2973	0.33	3osf:A, 3osf:D, 3osg:D
8	3zqc:J	119	39	0.1224	0.1008	0.3077	0.51	3zqc:A, 3zqc:D, 3zqc:G
9	4d26:A	430	57	0.1735	0.0395	0.2982	1.2	4d25:A
10	3wx7:A	402	44	0.1429	0.0348	0.3182	1.4	3wx7:B
11	1h88:C	152	39	0.1122	0.0724	0.2821	2.0	1h89:C, 1h8a:C, 1mse:C, 1msf:C
12	7mq8:LP	567	19	0.1020	0.0176	0.5263	2.4	7mq9:LP, 7mqa:LP
13	5h06:B	499	22	0.0918	0.0180	0.4091	5.1	5h05:A, 5h05:B, 5h05:C, 5h05:D, 5h06:A, 5h06:C, 5h06:D
14	5eyb:A	340	63	0.1224	0.0353	0.1905	6.9	5eyb:B
15	2x7v:A	286	38	0.1633	0.0559	0.4211	7.5	4hno:A, 2x7w:A
16	6ahr:L	362	17	0.0918	0.0249	0.5294	7.6	6ahu:L
17	1jhd:A	396	43	0.1633	0.0404	0.3721	7.6

[Back]