BioLiP

>protein
SSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGH
SNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYFENGLPFEYVRTQYAGSRFEFYLE

The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ddv:B	139	138	1.0000	0.9928	1.0000	8.43e-100	3ddv:D
2	4u0v:A	243	134	0.2754	0.1564	0.2836	3.28e-17	4u0v:B, 4u0w:A, 4u0w:B, 4u0y:A, 4u0y:B, 4u0y:C, 4u0y:D, 4wwc:B
3	4wwc:A	213	134	0.2391	0.1549	0.2463	8.81e-10
4	4zsi:A	166	109	0.2101	0.1747	0.2661	1.00e-05	4zsi:B, 4zsk:A, 4zsk:B
5	7bvh:A	1035	89	0.1522	0.0203	0.2360	1.9	7bve:A, 7bve:B, 7bvh:B
6	4weq:A	316	20	0.0725	0.0316	0.5000	4.1	4z0p:A
7	1uef:A	105	91	0.1522	0.2000	0.2308	7.4	1uef:B
8	4eb5:A	379	72	0.1594	0.0580	0.3056	7.6	4eb5:B, 4eb7:A, 4eb7:B, 4hvk:A, 4r5f:A
9	4wuj:C	145	115	0.2029	0.1931	0.2435	7.7	4wuj:A, 4wuj:B, 4wuj:D
10	6xzd:BP1	712	61	0.1159	0.0225	0.2623	8.0	6xzp:BP1, 6xzq:B, 6xzr:BP1, 6y0c:B
11	6ldo:A	381	77	0.1304	0.0472	0.2338	8.1	6ldo:B, 6ldo:C, 6ldo:D, 6ldo:E, 6ldo:F, 6le4:A, 6le4:B, 6le4:C, 6le4:D, 6le4:E, 6le4:F
12	5kf2:A	317	65	0.1594	0.0694	0.3385	8.2	5kf1:A, 5kf1:B, 5kf8:A, 5kf9:A, 5kga:A, 5kga:B, 5kgh:A, 5kgh:B, 5kgj:A, 5kgp:A, 5kgp:B

[Back]