BioLiP

>protein
SSFGTPFERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMMVEN
NTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGF
KPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYRQA

The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3lqu:A	205	204	0.9951	0.9951	1.0000	1.94e-150	1g58:A, 3lrj:A, 3lrj:B, 3lrj:C, 3lrj:D, 3ls6:A, 3ls6:B
2	4p6p:B	218	203	0.6585	0.6193	0.6650	1.63e-95	4p6c:A, 4p6c:B, 4p6d:A, 4p6d:B, 4p6p:A, 4p77:A, 4p77:B, 4p8e:A, 4p8e:B, 7uf0:A, 7uf1:A, 7uf2:A, 7uf3:A, 7uf4:A, 7uf5:A
3	1tku:A	196	197	0.4585	0.4796	0.4772	2.55e-62	2riu:A, 1tku:B
4	1k4i:A	216	209	0.4585	0.4352	0.4498	5.16e-56	1k49:A, 1k4l:A, 1k4o:A, 1k4p:A
5	4i14:A	325	203	0.4341	0.2738	0.4384	7.08e-50	4i14:B, 3mio:A, 3mio:B
6	1pvw:A	219	218	0.3171	0.2968	0.2982	2.60e-26	1pvw:B, 1pvy:A, 1pvy:B, 1snn:A, 1snn:B
7	6ajc:A	413	172	0.2244	0.1114	0.2674	1.8	6ajc:B, 6ajc:C, 6ajc:D, 6ajc:E, 6ajc:F, 6ajc:G, 6ajc:H
8	7wrr:A	650	197	0.2341	0.0738	0.2437	3.6	7wrr:B, 7wrr:C, 7wrr:D, 7wrt:A, 7wrt:B, 7wrt:C, 7wrt:D
9	8q4h:A	503	72	0.1073	0.0437	0.3056	4.1	8q4h:B
10	8iqi:C	916	30	0.0488	0.0109	0.3333	5.7	8iqc:A, 8iqc:B, 8iqd:A, 8iqd:B, 8iqd:C, 8iqd:D, 8iqi:A, 8iqi:B, 8iqi:D, 8iqi:E, 8iqi:F
11	6aj6:A	413	153	0.1951	0.0969	0.2614	6.1	6aj6:C, 6aj8:A, 6aj8:B, 6aja:A, 6aja:B, 6aja:C, 6aja:D, 6ajb:A, 6ajb:B, 6ajb:C, 6ajb:D, 7e3n:A
12	8blw:B	626	56	0.0976	0.0319	0.3571	9.8	8ptd:A, 8ptf:A

[Back]