BioLiP

>protein
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6fgp:B	68	65	0.9692	0.9265	0.9692	4.15e-43	1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A
2	7f1t:A	423	66	0.4923	0.0757	0.4848	4.74e-20	6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A
3	2ra4:B	65	58	0.2923	0.2923	0.3276	1.24e-11
4	2mpm:A	74	61	0.3692	0.3243	0.3934	6.84e-11
5	4r8i:A	68	58	0.2923	0.2794	0.3276	1.02e-07
6	2hci:A	68	58	0.2923	0.2794	0.3276	9.11e-05
7	2nwg:A	68	45	0.2308	0.2206	0.3333	7.23e-04	2nwg:B, 4uai:A
8	6gwi:B	450	41	0.2154	0.0311	0.3415	0.13	6gwi:A
9	1ilp:A	71	57	0.1846	0.1690	0.2105	0.16	1ilq:A, 6xmn:A
10	4v6w:Ac	62	44	0.1846	0.1935	0.2727	0.79	6xu6:Ac, 6xu7:Ac, 6xu8:Ac
11	6edk:A	193	18	0.1077	0.0363	0.3889	2.2	6ci4:A, 6ci5:A
12	6q2m:A	544	22	0.1692	0.0202	0.5000	4.0	1ba3:A, 5dwv:A, 4e5d:A, 4g36:A, 4g36:B, 4g37:A, 4g37:B, 5gyz:A, 5gz2:A, 6hps:A, 6hps:B, 3ies:A, 5kyt:A, 5kyt:B, 5kyv:A, 5kyv:B, 6q2m:B, 6q2m:C, 3rix:A, 5wys:A
13	3e78:A	365	36	0.1692	0.0301	0.3056	7.1	3e79:A, 3eki:A
14	7t80:A	216	32	0.1846	0.0556	0.3750	8.4	7t80:B
15	8e0p:B	789	19	0.0923	0.0076	0.3158	8.7	8e0p:A, 8e0p:C, 8e0p:D
16	5mr0:D	290	32	0.1692	0.0379	0.3438	8.7	5mr0:A, 5mr0:B, 5mr0:C, 5mr0:E, 5mr0:F
17	2d74:B	137	33	0.1692	0.0803	0.3333	9.8	2dcu:B

[Back]