BioLiP

>protein
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

The query sequence (length=44) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1hym:A	44	44	1.0000	1.0000	1.0000	2.62e-26
2	1cir:A	39	38	0.3409	0.3846	0.3947	0.004	1ciq:A, 1cq4:A
3	1egp:A	39	36	0.2727	0.3077	0.3333	0.32
4	7lhv:A	575	33	0.3182	0.0243	0.4242	2.5	7lhv:B
5	1fgx:B	273	35	0.2955	0.0476	0.3714	3.1	1fr8:A, 1fr8:B, 2fyd:B, 2fyd:D, 1nf5:B, 1nf5:D, 1nhe:B, 1nhe:D, 1nkh:B, 1nkh:D, 1nwg:B, 1nwg:D, 1o23:B, 1o23:D, 1oqm:B, 1oqm:D, 1pzy:B, 1pzy:D, 1yro:B, 1yro:D
6	2agd:A	273	34	0.2727	0.0440	0.3529	4.0	2ae7:A, 2ae7:B, 2ae7:C, 2aec:A, 2aec:B, 2aec:C, 2aes:A, 2aes:B, 2aes:C, 2agd:B, 2agd:C, 2ah9:A, 2ah9:B, 2ah9:C, 3ee5:A, 3ee5:B, 3ee5:C, 4ee3:A, 4ee3:B, 4ee3:C, 4ee4:A, 4ee4:B, 4ee4:C, 4ee5:A, 4ee5:B, 4ee5:C, 4eea:A, 4eea:B, 4eea:C, 4eeg:A, 4eeg:B, 4eeg:C, 4eem:A, 4eem:B, 4eem:C, 4eeo:A, 4eeo:B, 4eeo:C, 2fya:A, 2fyb:A, 2fyc:B, 2fyc:D, 4krv:A, 4krv:B, 1o0r:A, 1o0r:B, 1tvy:A, 1tvy:B, 1tw1:A, 1tw1:B, 1tw5:A, 1tw5:B
7	1hdg:O	332	26	0.2045	0.0271	0.3462	5.2	1hdg:Q
8	2zb3:A	345	34	0.2273	0.0290	0.2941	6.3
9	5l8e:A	517	18	0.1818	0.0155	0.4444	6.4
10	3tqc:B	305	37	0.2727	0.0393	0.3243	7.0	3tqc:A
11	6yxy:EB	663	31	0.2273	0.0151	0.3226	7.9	7aoi:XB, 6yxx:EB
12	8pu0:A	1157	28	0.2273	0.0086	0.3571	8.8
13	8ptx:A	1215	28	0.2273	0.0082	0.3571	9.6

[Back]