SRWSSVWPNMHYGAMYLSYSIGRKLPMKGVNWVTRESNRLTNFSNRYQAVINDIDVKKTEEELGITLQDIRWNDHRRIYW
KCSFCGSSYRKSVSVRTKFHAGCNFCKGRYPSEVLREQHQSLSLAASAPELIKQLKETDKKDNLGSLALTSKFRAEWKCQ
SCGGSYRASVRSRTGMVENGQCPLHPNIVDWSAYCPSCSWRPNMEAIAEEVQRTGQFLGLEAESRKIASAPPARIPRRKK
LV
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aor:at | 242 | 242 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 7pub:DS | 243 | 242 | 0.7231 | 0.7202 | 0.7231 | 2.63e-133 | 6hiv:DS, 6hiw:DS, 6hiy:DS |
3 | 7ane:at | 204 | 204 | 0.5537 | 0.6569 | 0.6569 | 1.36e-101 | |
4 | 6yxx:E2 | 369 | 145 | 0.1240 | 0.0813 | 0.2069 | 0.010 | |
5 | 6yxx:E2 | 369 | 115 | 0.1322 | 0.0867 | 0.2783 | 0.21 | |
6 | 6sga:Fd | 96 | 29 | 0.0496 | 0.1250 | 0.4138 | 0.27 | 7pua:Fd, 6sgb:Fd |
7 | 6sga:Fd | 96 | 72 | 0.0785 | 0.1979 | 0.2639 | 0.75 | 7pua:Fd, 6sgb:Fd |
8 | 7dco:M | 176 | 71 | 0.0826 | 0.1136 | 0.2817 | 1.9 | 5gm6:a |
9 | 6f0y:A | 172 | 96 | 0.0909 | 0.1279 | 0.2292 | 2.1 | 2ygv:A, 2ygv:D, 2ygv:B, 2ygv:C |
10 | 8qxc:H | 221 | 60 | 0.0579 | 0.0633 | 0.2333 | 2.3 | 8qxc:A |
11 | 2i13:A | 151 | 118 | 0.1116 | 0.1788 | 0.2288 | 3.0 | |
12 | 6l3a:B | 393 | 71 | 0.0950 | 0.0585 | 0.3239 | 3.2 | 6l39:A, 6l39:B, 6l3a:A |
13 | 4odt:H | 226 | 60 | 0.0579 | 0.0619 | 0.2333 | 3.3 | 1cbv:H, 2hkf:H, 4z8f:H |
14 | 2eml:A | 46 | 25 | 0.0455 | 0.2391 | 0.4400 | 4.6 | |
15 | 5vh4:A | 220 | 70 | 0.0744 | 0.0818 | 0.2571 | 4.7 | |
16 | 8gym:m2 | 318 | 90 | 0.1074 | 0.0818 | 0.2889 | 5.5 | 8gym:M2 |
17 | 7z6h:K | 439 | 77 | 0.0744 | 0.0410 | 0.2338 | 6.2 | |
18 | 7odf:A | 703 | 73 | 0.0992 | 0.0341 | 0.3288 | 7.2 | |
19 | 3cxd:H | 216 | 60 | 0.0579 | 0.0648 | 0.2333 | 7.4 | 3dsf:H |
20 | 6y6n:A | 116 | 95 | 0.0868 | 0.1810 | 0.2211 | 7.4 | 6y6o:A |
21 | 8fve:B | 538 | 46 | 0.0661 | 0.0297 | 0.3478 | 7.5 | 2ad5:A, 2ad5:B, 8fv6:AAA, 8fv6:BBB, 8fv7:AAA, 8fv7:BBB, 8fv8:AAA, 8fv8:BBB, 8fv9:AAA, 8fv9:BBB, 8fva:AAA, 8fva:BBB, 8fvb:AAA, 8fvb:BBB, 8fvc:AAA, 8fvc:BBB, 8fvd:A, 8fvd:B, 8fve:A, 8i9o:A, 8i9o:B, 8i9o:D, 8i9o:C, 1s1m:A, 1s1m:B, 8sbr:A, 8sbr:B, 5tkv:A, 5tkv:B, 5u3c:A, 5u3c:B, 5u3c:C, 5u3c:D, 5u6r:A, 5u6r:B, 5u6r:C, 5u6r:D |
22 | 6g9w:B | 468 | 84 | 0.1033 | 0.0534 | 0.2976 | 8.2 | 6g9v:B, 6g9w:A, 6tn3:B |
23 | 4fab:H | 216 | 70 | 0.0744 | 0.0833 | 0.2571 | 9.1 | 1flr:H |
24 | 4qww:D | 225 | 73 | 0.0744 | 0.0800 | 0.2466 | 9.2 | 4qww:F, 3sge:H, 3sge:J |